BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS313E02f (521 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292362-1|CAL23174.2| 398|Tribolium castaneum gustatory recept... 24 0.94 AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory recept... 21 6.6 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 21 8.7 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 21 8.7 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 21 8.7 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 21 8.7 >AM292362-1|CAL23174.2| 398|Tribolium castaneum gustatory receptor candidate 41 protein. Length = 398 Score = 23.8 bits (49), Expect = 0.94 Identities = 13/53 (24%), Positives = 25/53 (47%) Frame = -3 Query: 504 WINSYVLNRRLRFWYQLFILIRFQIPYMYNATLVSNHYLGLIRMKHYCIHRSL 346 ++N YV + + +LIR +I + + + S H G I +H +H + Sbjct: 167 FVNEYVQAIEVLYICSYTVLIRNKISNLNTSLIHSTHLNGDIVKEHQNLHNKI 219 >AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory receptor candidate 51 protein. Length = 771 Score = 21.0 bits (42), Expect = 6.6 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = +2 Query: 155 YGYMILVVPIQTRSQLLRTSPKTYLE 232 +GY L++ SQL+ + KT L+ Sbjct: 371 FGYQTLLITFHIGSQLVLHTVKTVLK 396 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 20.6 bits (41), Expect = 8.7 Identities = 7/19 (36%), Positives = 10/19 (52%) Frame = +1 Query: 283 TARIWDPRAAPRTRCQKIF 339 T IW P+ R +K+F Sbjct: 478 TLHIWTPKCERLARTEKLF 496 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 20.6 bits (41), Expect = 8.7 Identities = 7/19 (36%), Positives = 10/19 (52%) Frame = +1 Query: 283 TARIWDPRAAPRTRCQKIF 339 T IW P+ R +K+F Sbjct: 478 TLHIWTPKCERLARTEKLF 496 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 20.6 bits (41), Expect = 8.7 Identities = 7/19 (36%), Positives = 10/19 (52%) Frame = +1 Query: 283 TARIWDPRAAPRTRCQKIF 339 T IW P+ R +K+F Sbjct: 478 TLHIWTPKCERLARTEKLF 496 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 20.6 bits (41), Expect = 8.7 Identities = 7/19 (36%), Positives = 10/19 (52%) Frame = +1 Query: 283 TARIWDPRAAPRTRCQKIF 339 T IW P+ R +K+F Sbjct: 478 TLHIWTPKCERLARTEKLF 496 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 139,229 Number of Sequences: 336 Number of extensions: 3254 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12573240 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -