BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS313E02f (521 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage prot... 24 0.82 AB207270-1|BAE72137.1| 429|Apis mellifera broad-complex protein. 23 1.9 DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholi... 23 2.5 DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholi... 23 2.5 DQ855482-1|ABH88169.1| 116|Apis mellifera chemosensory protein ... 22 3.3 AJ973399-1|CAJ01446.1| 116|Apis mellifera hypothetical protein ... 22 3.3 DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholi... 21 7.7 AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 21 7.7 >EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage protein protein. Length = 1010 Score = 24.2 bits (50), Expect = 0.82 Identities = 14/33 (42%), Positives = 20/33 (60%) Frame = +2 Query: 233 LGFRKMALGCTQEVRTAQPGYGIPGLHHVQGVK 331 LG + + G Q V+TAQ G+ G+ VQGV+ Sbjct: 835 LGVQGVQQG-VQGVQTAQGVQGVQGVQGVQGVQ 866 >AB207270-1|BAE72137.1| 429|Apis mellifera broad-complex protein. Length = 429 Score = 23.0 bits (47), Expect = 1.9 Identities = 7/31 (22%), Positives = 15/31 (48%) Frame = -2 Query: 451 HFDPFSDPIYV*CHSGLQPLSGTDQDEALLH 359 HF P + + CH + L+ + +++ H Sbjct: 395 HFQPLNSAVCALCHKVFRTLNSLNNHKSIYH 425 >DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 22.6 bits (46), Expect = 2.5 Identities = 8/31 (25%), Positives = 19/31 (61%) Frame = +1 Query: 142 WISALRLYDLSSANPDPVTTFEDISKNVSRV 234 ++SAL ++ + NPD ++D+ N +++ Sbjct: 13 FLSALVVHGAVAGNPDAKRLYDDLLSNYNKL 43 >DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 22.6 bits (46), Expect = 2.5 Identities = 8/31 (25%), Positives = 19/31 (61%) Frame = +1 Query: 142 WISALRLYDLSSANPDPVTTFEDISKNVSRV 234 ++SAL ++ + NPD ++D+ N +++ Sbjct: 13 FLSALVVHGAVAGNPDAKRLYDDLLSNYNKL 43 >DQ855482-1|ABH88169.1| 116|Apis mellifera chemosensory protein 1 protein. Length = 116 Score = 22.2 bits (45), Expect = 3.3 Identities = 8/28 (28%), Positives = 13/28 (46%) Frame = -3 Query: 270 SCVHPSAIFLKPNSRYVFGDVLKSCDRV 187 SC+ P ++F K + F K C + Sbjct: 54 SCLTPDSVFFKSHITEAFQTQCKKCTEI 81 >AJ973399-1|CAJ01446.1| 116|Apis mellifera hypothetical protein protein. Length = 116 Score = 22.2 bits (45), Expect = 3.3 Identities = 8/28 (28%), Positives = 13/28 (46%) Frame = -3 Query: 270 SCVHPSAIFLKPNSRYVFGDVLKSCDRV 187 SC+ P ++F K + F K C + Sbjct: 54 SCLTPDSVFFKSHITEAFQTQCKKCTEI 81 >DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholine receptor alpha1subunit protein. Length = 601 Score = 21.0 bits (42), Expect = 7.7 Identities = 8/22 (36%), Positives = 12/22 (54%) Frame = -2 Query: 358 SPELELGISFDTLYVVQPWDPI 293 S ++E+GI Y+ WD I Sbjct: 184 SNQIEVGIDLTDYYISVEWDII 205 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 21.0 bits (42), Expect = 7.7 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = +2 Query: 248 MALGCTQEVRTAQPG 292 + LGCT+ A+PG Sbjct: 7 IVLGCTRSAHFARPG 21 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 159,029 Number of Sequences: 438 Number of extensions: 3650 Number of successful extensions: 13 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14600229 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -