BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS313D12f (521 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_56184| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.4 SB_45581| Best HMM Match : Ras (HMM E-Value=0.069) 28 5.4 >SB_56184| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 242 Score = 27.9 bits (59), Expect = 5.4 Identities = 15/48 (31%), Positives = 24/48 (50%), Gaps = 1/48 (2%) Frame = +3 Query: 294 VPEEPKSTESVSK-RSDMTCFRRRRLCFAPSPGSDTYVVSGGCYDSYR 434 VPE T+++ D+T + ++L S G D + +G C D YR Sbjct: 195 VPEANHITDNLRAFEFDLTDYDMQKLNKVVSKGCDLFAATGDCGDEYR 242 >SB_45581| Best HMM Match : Ras (HMM E-Value=0.069) Length = 284 Score = 27.9 bits (59), Expect = 5.4 Identities = 14/51 (27%), Positives = 27/51 (52%), Gaps = 2/51 (3%) Frame = -1 Query: 461 SSTLKKRRGTITVITATANYICIRPRRRGKAKPPSPKTC--HVRSLRYTLG 315 ++ LK R + + T Y+ +R + +P +PK C H+R+ + T+G Sbjct: 57 NTMLKIREPQLISQSCTDGYVYLRTAKDTYGRPGTPKDCKVHLRTAKDTIG 107 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,338,036 Number of Sequences: 59808 Number of extensions: 251480 Number of successful extensions: 598 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 557 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 598 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1172759136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -