BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS313D12f (521 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z73427-8|CAA97804.1| 302|Caenorhabditis elegans Hypothetical pr... 28 4.7 AF100304-4|AAC68910.1| 568|Caenorhabditis elegans Gex interacti... 27 6.2 AF100304-2|AAU20837.1| 564|Caenorhabditis elegans Gex interacti... 27 6.2 AF100304-1|AAC68913.1| 545|Caenorhabditis elegans Gex interacti... 27 6.2 >Z73427-8|CAA97804.1| 302|Caenorhabditis elegans Hypothetical protein F58B3.8 protein. Length = 302 Score = 27.9 bits (59), Expect = 4.7 Identities = 13/31 (41%), Positives = 17/31 (54%), Gaps = 2/31 (6%) Frame = -2 Query: 211 CDSDSVVNSAKHCSCQG--*C*QILSG*SCK 125 CD + NS KHC+ QG C L+G C+ Sbjct: 151 CDENKATNSGKHCNFQGKPSCLNGLTGSKCE 181 >AF100304-4|AAC68910.1| 568|Caenorhabditis elegans Gex interacting protein protein4, isoform b protein. Length = 568 Score = 27.5 bits (58), Expect = 6.2 Identities = 14/36 (38%), Positives = 21/36 (58%), Gaps = 3/36 (8%) Frame = -2 Query: 391 DPGDGAKQSR---RRRKHVMSDLLDTLSVLLGSSGT 293 D GD Q R +RR++ M D++ + +GSSGT Sbjct: 390 DLGDSYNQKRYTPKRRRNEMDDMISAGQMAVGSSGT 425 >AF100304-2|AAU20837.1| 564|Caenorhabditis elegans Gex interacting protein protein4, isoform f protein. Length = 564 Score = 27.5 bits (58), Expect = 6.2 Identities = 14/36 (38%), Positives = 21/36 (58%), Gaps = 3/36 (8%) Frame = -2 Query: 391 DPGDGAKQSR---RRRKHVMSDLLDTLSVLLGSSGT 293 D GD Q R +RR++ M D++ + +GSSGT Sbjct: 386 DLGDSYNQKRYTPKRRRNEMDDMISAGQMAVGSSGT 421 >AF100304-1|AAC68913.1| 545|Caenorhabditis elegans Gex interacting protein protein4, isoform a protein. Length = 545 Score = 27.5 bits (58), Expect = 6.2 Identities = 14/36 (38%), Positives = 21/36 (58%), Gaps = 3/36 (8%) Frame = -2 Query: 391 DPGDGAKQSR---RRRKHVMSDLLDTLSVLLGSSGT 293 D GD Q R +RR++ M D++ + +GSSGT Sbjct: 367 DLGDSYNQKRYTPKRRRNEMDDMISAGQMAVGSSGT 402 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,862,691 Number of Sequences: 27780 Number of extensions: 180222 Number of successful extensions: 391 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 384 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 391 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 1017709248 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -