BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS313D03f (408 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskel... 22 7.5 AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical prote... 22 9.9 >CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskeletal structural protein protein. Length = 1645 Score = 22.2 bits (45), Expect = 7.5 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = +1 Query: 1 FRLNTASRETRANMQHEREFSVW 69 F++ +SR +N+ ERE S W Sbjct: 623 FKVQWSSRSDFSNVVGEREISEW 645 >AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical protein protein. Length = 1645 Score = 21.8 bits (44), Expect = 9.9 Identities = 12/35 (34%), Positives = 15/35 (42%) Frame = +1 Query: 205 GNEDEQRNALYAMNGYCGLGTKPLKICTAVPKPKS 309 G + AL + G+ PL TAVP P S Sbjct: 1243 GQDYAPPRALMSAGGFASPPASPLVPDTAVPDPHS 1277 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.135 0.415 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 387,214 Number of Sequences: 2352 Number of extensions: 7179 Number of successful extensions: 38 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 38 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 38 length of database: 563,979 effective HSP length: 58 effective length of database: 427,563 effective search space used: 32922351 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -