BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS313D03f (408 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g19130.1 68416.m02429 RNA-binding protein, putative similar t... 94 4e-20 At1g47490.2 68414.m05269 RNA-binding protein 47 (RBP47), putativ... 90 5e-19 At1g47490.1 68414.m05270 RNA-binding protein 47 (RBP47), putativ... 90 5e-19 At1g49600.1 68414.m05561 RNA-binding protein 47 (RBP47), putativ... 90 6e-19 At5g19350.1 68418.m02306 RNA-binding protein 45 (RBP45), putative 89 1e-18 At1g47500.1 68414.m05272 RNA-binding protein 47 (RBP47), putativ... 89 1e-18 At1g11650.2 68414.m01337 RNA-binding protein 45 (RBP45), putativ... 87 6e-18 At1g11650.1 68414.m01336 RNA-binding protein 45 (RBP45), putativ... 87 6e-18 At5g54900.1 68418.m06838 RNA-binding protein 45 (RBP45), putativ... 81 2e-16 At4g27000.1 68417.m03884 RNA-binding protein 45 (RBP45), putativ... 80 6e-16 At3g14100.1 68416.m01782 oligouridylate-binding protein, putativ... 58 2e-09 At1g54080.1 68414.m06162 oligouridylate-binding protein, putativ... 56 1e-08 At1g22760.1 68414.m02844 polyadenylate-binding protein 3 (PABP3) 56 1e-08 At3g04500.1 68416.m00477 RNA recognition motif (RRM)-containing ... 55 2e-08 At1g34140.1 68414.m04235 polyadenylate-binding protein, putative... 53 6e-08 At5g51300.2 68418.m06360 splicing factor-related contains simila... 53 9e-08 At5g51300.1 68418.m06359 splicing factor-related contains simila... 53 9e-08 At4g24770.1 68417.m03546 31 kDa ribonucleoprotein, chloroplast, ... 52 1e-07 At5g47320.1 68418.m05833 30S ribosomal protein S19, mitochondria... 52 1e-07 At5g50250.1 68418.m06223 31 kDa ribonucleoprotein, chloroplast, ... 51 3e-07 At1g71770.1 68414.m08295 polyadenylate-binding protein 5 (PABP5)... 51 3e-07 At1g17370.1 68414.m02118 oligouridylate-binding protein, putativ... 51 3e-07 At2g23350.1 68415.m02788 polyadenylate-binding protein, putative... 51 3e-07 At1g54080.2 68414.m06163 oligouridylate-binding protein, putativ... 50 5e-07 At2g37220.1 68415.m04566 29 kDa ribonucleoprotein, chloroplast, ... 50 6e-07 At4g34110.1 68417.m04839 polyadenylate-binding protein 2 (PABP2)... 48 2e-06 At4g39260.4 68417.m05560 glycine-rich RNA-binding protein 8 (GRP... 47 4e-06 At3g16380.1 68416.m02074 polyadenylate-binding protein, putative... 47 4e-06 At3g53460.2 68416.m05901 29 kDa ribonucleoprotein, chloroplast /... 47 6e-06 At3g53460.1 68416.m05900 29 kDa ribonucleoprotein, chloroplast /... 47 6e-06 At2g16260.1 68415.m01862 glycine-rich RNA-binding protein, putat... 47 6e-06 At5g19960.1 68418.m02376 RNA recognition motif (RRM)-containing ... 46 1e-05 At4g39260.3 68417.m05559 glycine-rich RNA-binding protein 8 (GRP... 46 1e-05 At4g39260.2 68417.m05558 glycine-rich RNA-binding protein 8 (GRP... 46 1e-05 At4g39260.1 68417.m05557 glycine-rich RNA-binding protein 8 (GRP... 46 1e-05 At2g16940.1 68415.m01952 RNA recognition motif (RRM)-containing ... 46 1e-05 At5g54580.1 68418.m06794 RNA recognition motif (RRM)-containing ... 46 1e-05 At3g26420.1 68416.m03295 glycine-rich RNA-binding protein simila... 46 1e-05 At3g23830.2 68416.m02996 glycine-rich RNA-binding protein, putat... 46 1e-05 At3g23830.1 68416.m02995 glycine-rich RNA-binding protein, putat... 46 1e-05 At1g49760.1 68414.m05580 polyadenylate-binding protein, putative... 46 1e-05 At3g08000.1 68416.m00977 RNA-binding protein, putative similar t... 45 2e-05 At2g21660.2 68415.m02578 glycine-rich RNA-binding protein (GRP7)... 44 3e-05 At2g21660.1 68415.m02577 glycine-rich RNA-binding protein (GRP7)... 44 3e-05 At5g04280.1 68418.m00421 glycine-rich RNA-binding protein 44 4e-05 At3g46020.1 68416.m04979 RNA-binding protein, putative similar t... 42 1e-04 At3g11400.1 68416.m01390 eukaryotic translation initiation facto... 42 1e-04 At4g13850.2 68417.m02146 glycine-rich RNA-binding protein (GRP2)... 42 2e-04 At4g13850.1 68417.m02145 glycine-rich RNA-binding protein (GRP2)... 42 2e-04 At2g18510.1 68415.m02157 pre-mRNA splicing factor, putative simi... 42 2e-04 At1g18630.1 68414.m02322 glycine-rich RNA-binding protein, putat... 42 2e-04 At1g60000.1 68414.m06759 29 kDa ribonucleoprotein, chloroplast, ... 40 6e-04 At5g06210.1 68418.m00693 RNA-binding protein, putative contains ... 39 0.001 At1g03457.2 68414.m00327 RNA-binding protein, putative similar t... 39 0.001 At1g03457.1 68414.m00326 RNA-binding protein, putative similar t... 39 0.001 At2g36660.1 68415.m04496 polyadenylate-binding protein, putative... 38 0.003 At1g20880.1 68414.m02615 RNA recognition motif (RRM)-containing ... 38 0.003 At4g36960.1 68417.m05238 RNA recognition motif (RRM)-containing ... 38 0.003 At2g21690.1 68415.m02580 RNA-binding protein, putative similar t... 38 0.003 At1g60650.2 68414.m06828 glycine-rich RNA-binding protein, putat... 38 0.003 At1g60650.1 68414.m06827 glycine-rich RNA-binding protein, putat... 38 0.003 At5g19030.2 68418.m02262 RNA recognition motif (RRM)-containing ... 37 0.005 At5g19030.1 68418.m02261 RNA recognition motif (RRM)-containing ... 37 0.005 At4g13860.1 68417.m02147 glycine-rich RNA-binding protein, putat... 37 0.005 At2g35410.1 68415.m04340 33 kDa ribonucleoprotein, chloroplast, ... 37 0.005 At5g09880.1 68418.m01142 RNA recognition motif (RRM)-containing ... 36 0.008 At4g03110.1 68417.m00420 RNA-binding protein, putative similar t... 36 0.008 At3g52380.1 68416.m05757 33 kDa ribonucleoprotein, chloroplast, ... 36 0.008 At2g41060.1 68415.m05070 RNA recognition motif (RRM)-containing ... 36 0.008 At1g76460.1 68414.m08893 RNA recognition motif (RRM)-containing ... 36 0.008 At1g58470.1 68414.m06651 RNA-binding protein (XF41) identical to... 36 0.008 At5g06000.1 68418.m00665 eukaryotic translation initiation facto... 36 0.010 At1g51510.1 68414.m05797 RNA-binding protein, putative similar t... 36 0.010 At3g52150.1 68416.m05724 RNA recognition motif (RRM)-containing ... 36 0.014 At5g40490.1 68418.m04910 RNA recognition motif (RRM)-containing ... 35 0.018 At3g56860.3 68416.m06325 UBP1 interacting protein 2a (UBA2a) ide... 35 0.018 At3g56860.2 68416.m06324 UBP1 interacting protein 2a (UBA2a) ide... 35 0.018 At3g56860.1 68416.m06323 UBP1 interacting protein 2a (UBA2a) ide... 35 0.018 At4g16280.3 68417.m02471 flowering time control protein / FCA ga... 35 0.024 At4g16280.2 68417.m02470 flowering time control protein / FCA ga... 35 0.024 At2g46780.1 68415.m05836 RNA recognition motif (RRM)-containing ... 35 0.024 At2g21440.1 68415.m02551 RNA recognition motif (RRM)-containing ... 35 0.024 At5g41690.1 68418.m05067 polyadenylate-binding protein, putative... 34 0.032 At4g14300.1 68417.m02203 heterogeneous nuclear ribonucleoprotein... 34 0.032 At1g78260.2 68414.m09119 RNA recognition motif (RRM)-containing ... 34 0.032 At1g78260.1 68414.m09120 RNA recognition motif (RRM)-containing ... 34 0.032 At4g03110.2 68417.m00421 RNA-binding protein, putative similar t... 34 0.042 At5g59860.1 68418.m07506 RNA recognition motif (RRM)-containing ... 33 0.074 At3g15010.2 68416.m01899 RNA recognition motif (RRM)-containing ... 33 0.074 At3g15010.1 68416.m01898 RNA recognition motif (RRM)-containing ... 33 0.074 At2g33410.1 68415.m04095 heterogeneous nuclear ribonucleoprotein... 33 0.074 At1g33470.2 68414.m04143 RNA recognition motif (RRM)-containing ... 33 0.074 At1g33470.1 68414.m04142 RNA recognition motif (RRM)-containing ... 33 0.074 At1g53720.1 68414.m06113 cyclophilin-RNA interacting protein, pu... 33 0.097 At3g47120.1 68416.m05116 RNA recognition motif (RRM)-containing ... 32 0.13 At1g22910.3 68414.m02863 RNA recognition motif (RRM)-containing ... 32 0.13 At1g22910.2 68414.m02861 RNA recognition motif (RRM)-containing ... 32 0.13 At1g22910.1 68414.m02862 RNA recognition motif (RRM)-containing ... 32 0.13 At1g22330.1 68414.m02793 RNA recognition motif (RRM)-containing ... 32 0.13 At2g43370.1 68415.m05392 U1 small nuclear ribonucleoprotein 70 k... 32 0.17 At2g37510.1 68415.m04600 RNA-binding protein, putative similar t... 32 0.17 At2g19380.1 68415.m02260 RNA recognition motif (RRM)-containing ... 31 0.22 At2g47310.1 68415.m05906 flowering time control protein-related ... 31 0.30 At4g02430.2 68417.m00330 pre-mRNA splicing factor, putative / SR... 31 0.39 At4g02430.1 68417.m00329 pre-mRNA splicing factor, putative / SR... 31 0.39 At5g25060.1 68418.m02970 RNA recognition motif (RRM)-containing ... 30 0.52 At4g09040.1 68417.m01491 RNA recognition motif (RRM)-containing ... 30 0.52 At1g02840.3 68414.m00246 pre-mRNA splicing factor SF2 (SF2) / SR... 30 0.52 At1g02840.2 68414.m00244 pre-mRNA splicing factor SF2 (SF2) / SR... 30 0.52 At1g02840.1 68414.m00245 pre-mRNA splicing factor SF2 (SF2) / SR... 30 0.52 At4g00830.1 68417.m00114 RNA recognition motif (RRM)-containing ... 30 0.69 At4g26650.1 68417.m03840 RNA recognition motif (RRM)-containing ... 29 0.91 At5g64200.2 68418.m08063 arginine/serine-rich splicing factor SC... 29 1.6 At5g64200.1 68418.m08062 arginine/serine-rich splicing factor SC... 29 1.6 At3g20930.1 68416.m02645 RNA recognition motif (RRM)-containing ... 29 1.6 At3g10845.1 68416.m01306 RNA recognition motif (RRM)-containing ... 29 1.6 At5g04600.1 68418.m00460 RNA recognition motif (RRM)-containing ... 28 2.1 At3g13570.1 68416.m01707 SC35-like splicing factor, 30a kD (SCL3... 28 2.1 At2g44710.1 68415.m05564 RNA recognition motif (RRM)-containing ... 28 2.1 At2g22100.1 68415.m02625 RNA recognition motif (RRM)-containing ... 28 2.8 At1g55310.1 68414.m06318 SC35-like splicing factor, 33 kD (SCL33... 28 2.8 At3g06970.1 68416.m00828 RNA recognition motif (RRM)-containing ... 27 3.7 At5g07290.1 68418.m00832 RNA recognition motif (RRM)-containing ... 27 4.8 At4g33890.2 68417.m04809 expressed protein 27 4.8 At4g33890.1 68417.m04808 expressed protein 27 4.8 At3g48210.1 68416.m05260 expressed protein 27 4.8 At2g43410.1 68415.m05395 RNA recognition motif (RRM)-containing ... 27 4.8 At1g73530.1 68414.m08511 RNA recognition motif (RRM)-containing ... 27 4.8 At2g22090.2 68415.m02624 UBP1 interacting protein 1a (UBA1a) nea... 27 6.4 At2g22090.1 68415.m02623 UBP1 interacting protein 1a (UBA1a) nea... 27 6.4 At1g09140.1 68414.m01018 SF2/ASF-like splicing modulator (SRP30)... 27 6.4 >At3g19130.1 68416.m02429 RNA-binding protein, putative similar to RNA Binding Protein 47 [Nicotiana plumbaginifolia] GI:9663769, DNA binding protein ACBF GB:AAC49850 from [Nicotiana tabacum]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 435 Score = 93.9 bits (223), Expect = 4e-20 Identities = 49/104 (47%), Positives = 72/104 (69%), Gaps = 4/104 (3%) Frame = +1 Query: 1 FRLNTASRET--RANMQHEREFSVWVGDLSPDVDDYSLYRVFASKYTSIKTAKVILD-NS 171 FR+N AS T + +++ + SV+VGDLSPDV D L+ F+ +Y S+K+AKV++D N+ Sbjct: 181 FRINWASFSTGEKRAVENGPDLSVFVGDLSPDVTDVLLHETFSDRYPSVKSAKVVIDSNT 240 Query: 172 GYTKGYGFVRFGNEDEQRNALYAMNG-YCGLGTKPLKICTAVPK 300 G +KGYGFVRFG+E+E+ AL MNG YC + +++ A PK Sbjct: 241 GRSKGYGFVRFGDENERSRALTEMNGAYC--SNRQMRVGIATPK 282 Score = 34.3 bits (75), Expect = 0.032 Identities = 19/63 (30%), Positives = 36/63 (57%) Frame = +1 Query: 61 SVWVGDLSPDVDDYSLYRVFASKYTSIKTAKVILDNSGYTKGYGFVRFGNEDEQRNALYA 240 +++VG + PDV D L + F S++ + + K+ + KG GFV+F + +A+ + Sbjct: 322 TIFVGGIDPDVIDEDLRQPF-SQFGEVVSVKIPVG-----KGCGFVQFADRKSAEDAIES 375 Query: 241 MNG 249 +NG Sbjct: 376 LNG 378 Score = 32.3 bits (70), Expect = 0.13 Identities = 18/49 (36%), Positives = 29/49 (59%), Gaps = 1/49 (2%) Frame = +1 Query: 61 SVWVGDLSPDVDDYSLYRVFASKYTSIKTAKVILDN-SGYTKGYGFVRF 204 ++WVGDL +D+ L+ F S + + KVI + + ++GYGFV F Sbjct: 109 TLWVGDLLHWMDETYLHSCF-SHTGEVSSVKVIRNKLTSQSEGYGFVEF 156 >At1g47490.2 68414.m05269 RNA-binding protein 47 (RBP47), putative similar to DNA binding protein GI:1899187 from [Nicotiana tabacum] Length = 310 Score = 90.2 bits (214), Expect = 5e-19 Identities = 50/107 (46%), Positives = 69/107 (64%), Gaps = 3/107 (2%) Frame = +1 Query: 1 FRLNTASRETRANMQHER--EFSVWVGDLSPDVDDYSLYRVFASKYTSIKTAKVILD-NS 171 FRLN AS T + S++VGDLSPDV D L+ F+ KY S+K AKV+LD N+ Sbjct: 176 FRLNWASFSTGEKRLENNGPDLSIFVGDLSPDVSDNLLHETFSEKYPSVKAAKVVLDANT 235 Query: 172 GYTKGYGFVRFGNEDEQRNALYAMNGYCGLGTKPLKICTAVPKPKSN 312 G +KGYGFVRFG+E+E+ A+ MNG ++ ++I A P+ K+N Sbjct: 236 GRSKGYGFVRFGDENERTKAMTEMNG-VKCSSRAMRIGPATPR-KTN 280 Score = 43.2 bits (97), Expect = 7e-05 Identities = 26/65 (40%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +1 Query: 61 SVWVGDLSPDVDDYSLYRVFAS-KYTSIKTAKVILD-NSGYTKGYGFVRFGNEDEQRNAL 234 ++WVGDL +D+ L FAS I + KVI + N+G ++GYGFV F + D L Sbjct: 102 TIWVGDLHHWMDEAYLNSSFASGDEREIVSVKVIRNKNNGLSEGYGFVEFESHDVADKVL 161 Query: 235 YAMNG 249 NG Sbjct: 162 REFNG 166 >At1g47490.1 68414.m05270 RNA-binding protein 47 (RBP47), putative similar to DNA binding protein GI:1899187 from [Nicotiana tabacum] Length = 432 Score = 90.2 bits (214), Expect = 5e-19 Identities = 50/107 (46%), Positives = 69/107 (64%), Gaps = 3/107 (2%) Frame = +1 Query: 1 FRLNTASRETRANMQHER--EFSVWVGDLSPDVDDYSLYRVFASKYTSIKTAKVILD-NS 171 FRLN AS T + S++VGDLSPDV D L+ F+ KY S+K AKV+LD N+ Sbjct: 176 FRLNWASFSTGEKRLENNGPDLSIFVGDLSPDVSDNLLHETFSEKYPSVKAAKVVLDANT 235 Query: 172 GYTKGYGFVRFGNEDEQRNALYAMNGYCGLGTKPLKICTAVPKPKSN 312 G +KGYGFVRFG+E+E+ A+ MNG ++ ++I A P+ K+N Sbjct: 236 GRSKGYGFVRFGDENERTKAMTEMNG-VKCSSRAMRIGPATPR-KTN 280 Score = 43.2 bits (97), Expect = 7e-05 Identities = 26/65 (40%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +1 Query: 61 SVWVGDLSPDVDDYSLYRVFAS-KYTSIKTAKVILD-NSGYTKGYGFVRFGNEDEQRNAL 234 ++WVGDL +D+ L FAS I + KVI + N+G ++GYGFV F + D L Sbjct: 102 TIWVGDLHHWMDEAYLNSSFASGDEREIVSVKVIRNKNNGLSEGYGFVEFESHDVADKVL 161 Query: 235 YAMNG 249 NG Sbjct: 162 REFNG 166 Score = 29.9 bits (64), Expect = 0.69 Identities = 20/63 (31%), Positives = 32/63 (50%) Frame = +1 Query: 61 SVWVGDLSPDVDDYSLYRVFASKYTSIKTAKVILDNSGYTKGYGFVRFGNEDEQRNALYA 240 +++VG L V D L + F +++ I + K+ + KG GFV+F N AL Sbjct: 305 TIFVGGLDSSVTDEDLKQPF-NEFGEIVSVKIPVG-----KGCGFVQFVNRPNAEEALEK 358 Query: 241 MNG 249 +NG Sbjct: 359 LNG 361 >At1g49600.1 68414.m05561 RNA-binding protein 47 (RBP47), putative similar to DNA binding protein ACBF GB:U90212 GI:1899187 from [Nicotiana tabacum] Length = 445 Score = 89.8 bits (213), Expect = 6e-19 Identities = 48/104 (46%), Positives = 68/104 (65%), Gaps = 4/104 (3%) Frame = +1 Query: 1 FRLNTASRETRANMQHER--EFSVWVGDLSPDVDDYSLYRVFASKYTSIKTAKVILD-NS 171 FRLN AS T E + S++VGDL+PDV D L FA +Y S+K AKV++D N+ Sbjct: 192 FRLNWASFSTGEKRASENGPDLSIFVGDLAPDVSDAVLLETFAGRYPSVKGAKVVIDSNT 251 Query: 172 GYTKGYGFVRFGNEDEQRNALYAMNG-YCGLGTKPLKICTAVPK 300 G +KGYGFVRFG+E+E+ A+ MNG +C ++ +++ A PK Sbjct: 252 GRSKGYGFVRFGDENERSRAMTEMNGAFC--SSRQMRVGIATPK 293 Score = 35.9 bits (79), Expect = 0.010 Identities = 21/64 (32%), Positives = 34/64 (53%), Gaps = 1/64 (1%) Frame = +1 Query: 61 SVWVGDLSPDVDDYSLYRVFASKYTSIKTAKVILDNSG-YTKGYGFVRFGNEDEQRNALY 237 ++WVGDL +D+ L+ F S + + KVI + ++GYGFV F + AL Sbjct: 120 TLWVGDLLHWMDETYLHTCF-SHTNEVSSVKVIRNKQTCQSEGYGFVEFLSRSAAEEALQ 178 Query: 238 AMNG 249 + +G Sbjct: 179 SFSG 182 Score = 31.1 bits (67), Expect = 0.30 Identities = 19/63 (30%), Positives = 32/63 (50%) Frame = +1 Query: 61 SVWVGDLSPDVDDYSLYRVFASKYTSIKTAKVILDNSGYTKGYGFVRFGNEDEQRNALYA 240 +++VG L DV + L + F S + + + K+ + KG GFV+F N A+ Sbjct: 328 TIFVGGLDADVTEEDLMQPF-SDFGEVVSVKIPVG-----KGCGFVQFANRQSAEEAIGN 381 Query: 241 MNG 249 +NG Sbjct: 382 LNG 384 >At5g19350.1 68418.m02306 RNA-binding protein 45 (RBP45), putative Length = 425 Score = 89.0 bits (211), Expect = 1e-18 Identities = 46/102 (45%), Positives = 65/102 (63%), Gaps = 2/102 (1%) Frame = +1 Query: 1 FRLNTASRETRANMQHEREFSVWVGDLSPDVDDYSLYRVFASKYTSIKTAKVILD-NSGY 177 FRLN AS + + + S++VGDL+PDV DY L F Y+S++ AKV+ D ++G Sbjct: 97 FRLNWASFGSGQKVDAGPDHSIFVGDLAPDVTDYLLQETFRVHYSSVRGAKVVTDPSTGR 156 Query: 178 TKGYGFVRFGNEDEQRNALYAMNG-YCGLGTKPLKICTAVPK 300 +KGYGFV+F E E+ A+ MNG YC T+P++I A PK Sbjct: 157 SKGYGFVKFAEESERNRAMAEMNGLYC--STRPMRISAATPK 196 Score = 35.9 bits (79), Expect = 0.010 Identities = 23/71 (32%), Positives = 36/71 (50%), Gaps = 1/71 (1%) Frame = +1 Query: 61 SVWVGDLSPDVDDYSLYRVFASKYTSIKTAKVILDN-SGYTKGYGFVRFGNEDEQRNALY 237 ++W+GDL VD+ L F S+ + + KVI + +G +GYGF+ F + L Sbjct: 25 TLWIGDLQYWVDENYLTSCF-SQTGELVSVKVIRNKITGQPEGYGFIEFISHAAAERTLQ 83 Query: 238 AMNGYCGLGTK 270 NG GT+ Sbjct: 84 TYNGTQMPGTE 94 Score = 26.6 bits (56), Expect = 6.4 Identities = 19/74 (25%), Positives = 35/74 (47%) Frame = +1 Query: 61 SVWVGDLSPDVDDYSLYRVFASKYTSIKTAKVILDNSGYTKGYGFVRFGNEDEQRNALYA 240 ++ V +L +V + L + F+ + +VI TKGYG+V+F A+ Sbjct: 238 TISVANLDQNVTEEELKKAFS------QLGEVIYVKIPATKGYGYVQFKTRPSAEEAVQR 291 Query: 241 MNGYCGLGTKPLKI 282 M G +G + ++I Sbjct: 292 MQGQV-IGQQAVRI 304 >At1g47500.1 68414.m05272 RNA-binding protein 47 (RBP47), putative similar to DNA binding protein GI:1899187 from [Nicotiana tabacum] Length = 434 Score = 89.0 bits (211), Expect = 1e-18 Identities = 49/107 (45%), Positives = 69/107 (64%), Gaps = 3/107 (2%) Frame = +1 Query: 1 FRLNTASRETRANMQHER--EFSVWVGDLSPDVDDYSLYRVFASKYTSIKTAKVILD-NS 171 FRLN AS T + S++VGDL+PDV D L+ F+ KY S+K AKV+LD N+ Sbjct: 178 FRLNWASFSTGEKRLENNGPDLSIFVGDLAPDVSDALLHETFSEKYPSVKAAKVVLDANT 237 Query: 172 GYTKGYGFVRFGNEDEQRNALYAMNGYCGLGTKPLKICTAVPKPKSN 312 G +KGYGFVRFG+E+E+ A+ MNG ++ ++I A P+ K+N Sbjct: 238 GRSKGYGFVRFGDENERTKAMTEMNG-VKCSSRAMRIGPATPR-KTN 282 Score = 41.1 bits (92), Expect = 3e-04 Identities = 24/65 (36%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +1 Query: 61 SVWVGDLSPDVDDYSLYRVFAS-KYTSIKTAKVILD-NSGYTKGYGFVRFGNEDEQRNAL 234 ++WVGDL +D+ L F S + I + KVI + ++G ++GYGFV F + D L Sbjct: 104 TIWVGDLQNWMDEAYLNSAFTSAEEREIVSLKVIRNKHNGSSEGYGFVEFESHDVADKVL 163 Query: 235 YAMNG 249 NG Sbjct: 164 QEFNG 168 Score = 31.1 bits (67), Expect = 0.30 Identities = 21/63 (33%), Positives = 32/63 (50%) Frame = +1 Query: 61 SVWVGDLSPDVDDYSLYRVFASKYTSIKTAKVILDNSGYTKGYGFVRFGNEDEQRNALYA 240 +++VG L V D L + F S++ I + K+ + KG GFV+F N AL Sbjct: 307 TIFVGGLDSSVTDEDLKQPF-SEFGEIVSVKIPVG-----KGCGFVQFVNRPNAEEALEK 360 Query: 241 MNG 249 +NG Sbjct: 361 LNG 363 >At1g11650.2 68414.m01337 RNA-binding protein 45 (RBP45), putative similar to gb|U90212 DNA binding protein ACBF from Nicotiana tabacum and contains 3 PF|00076 RNA recognition motif domains. ESTs gb|T44278, gb|R65195, gb|N65904, gb|H37499, gb|R90487, gb|N95952, gb|T44278, gb|Z20166, gb|N96891, gb|W43137, gb|F15504, gb|F1 Length = 405 Score = 86.6 bits (205), Expect = 6e-18 Identities = 45/101 (44%), Positives = 62/101 (61%), Gaps = 1/101 (0%) Frame = +1 Query: 1 FRLNTASRETRANMQHEREFSVWVGDLSPDVDDYSLYRVFASKYTSIKTAKVILDN-SGY 177 FRLN AS + +++++VGDL+ DV DY L F + Y S+K AKV++D +G Sbjct: 136 FRLNWASLSSGDKRDDSPDYTIFVGDLAADVTDYILLETFRASYPSVKGAKVVIDRVTGR 195 Query: 178 TKGYGFVRFGNEDEQRNALYAMNGYCGLGTKPLKICTAVPK 300 TKGYGFVRF +E EQ A+ MNG T+P++I A K Sbjct: 196 TKGYGFVRFSDESEQIRAMTEMNG-VPCSTRPMRIGPAASK 235 Score = 38.7 bits (86), Expect = 0.001 Identities = 21/63 (33%), Positives = 33/63 (52%), Gaps = 1/63 (1%) Frame = +1 Query: 61 SVWVGDLSPDVDDYSLYRVFASKYTSIKTAKVILDN-SGYTKGYGFVRFGNEDEQRNALY 237 ++W+GDL +D+ LY FA + +AKVI + +G +GYGF+ F + L Sbjct: 63 TLWIGDLQYWMDENFLYGCFAHTGEMV-SAKVIRNKQTGQVEGYGFIEFASHAAAERVLQ 121 Query: 238 AMN 246 N Sbjct: 122 TFN 124 >At1g11650.1 68414.m01336 RNA-binding protein 45 (RBP45), putative similar to gb|U90212 DNA binding protein ACBF from Nicotiana tabacum and contains 3 PF|00076 RNA recognition motif domains. ESTs gb|T44278, gb|R65195, gb|N65904, gb|H37499, gb|R90487, gb|N95952, gb|T44278, gb|Z20166, gb|N96891, gb|W43137, gb|F15504, gb|F1 Length = 306 Score = 86.6 bits (205), Expect = 6e-18 Identities = 45/101 (44%), Positives = 62/101 (61%), Gaps = 1/101 (0%) Frame = +1 Query: 1 FRLNTASRETRANMQHEREFSVWVGDLSPDVDDYSLYRVFASKYTSIKTAKVILDN-SGY 177 FRLN AS + +++++VGDL+ DV DY L F + Y S+K AKV++D +G Sbjct: 136 FRLNWASLSSGDKRDDSPDYTIFVGDLAADVTDYILLETFRASYPSVKGAKVVIDRVTGR 195 Query: 178 TKGYGFVRFGNEDEQRNALYAMNGYCGLGTKPLKICTAVPK 300 TKGYGFVRF +E EQ A+ MNG T+P++I A K Sbjct: 196 TKGYGFVRFSDESEQIRAMTEMNG-VPCSTRPMRIGPAASK 235 Score = 38.7 bits (86), Expect = 0.001 Identities = 21/63 (33%), Positives = 33/63 (52%), Gaps = 1/63 (1%) Frame = +1 Query: 61 SVWVGDLSPDVDDYSLYRVFASKYTSIKTAKVILDN-SGYTKGYGFVRFGNEDEQRNALY 237 ++W+GDL +D+ LY FA + +AKVI + +G +GYGF+ F + L Sbjct: 63 TLWIGDLQYWMDENFLYGCFAHTGEMV-SAKVIRNKQTGQVEGYGFIEFASHAAAERVLQ 121 Query: 238 AMN 246 N Sbjct: 122 TFN 124 >At5g54900.1 68418.m06838 RNA-binding protein 45 (RBP45), putative contains similarity to polyadenylate-binding protein 5 Length = 387 Score = 81.4 bits (192), Expect = 2e-16 Identities = 48/104 (46%), Positives = 65/104 (62%), Gaps = 4/104 (3%) Frame = +1 Query: 1 FRLNTASRET-RANMQHER-EFSVWVGDLSPDVDDYSLYRVFASKYTSIKTAKVILD-NS 171 FRLN A Q E + +++VGDL+P+V DY L F + Y S+K AKV+LD + Sbjct: 133 FRLNWAQAGAGEKRFQTEGPDHTIFVGDLAPEVTDYMLSDTFKNVYGSVKGAKVVLDRTT 192 Query: 172 GYTKGYGFVRFGNEDEQRNALYAMNG-YCGLGTKPLKICTAVPK 300 G +KGYGFVRF +E+EQ A+ MNG YC T+P++I A K Sbjct: 193 GRSKGYGFVRFADENEQMRAMTEMNGQYC--STRPMRIGPAANK 234 Score = 40.7 bits (91), Expect = 4e-04 Identities = 22/64 (34%), Positives = 35/64 (54%), Gaps = 1/64 (1%) Frame = +1 Query: 61 SVWVGDLSPDVDDYSLYRVFASKYTSIKTAKVILDN-SGYTKGYGFVRFGNEDEQRNALY 237 S+W+GDL +D+ + VFA + +AKVI + +G ++GYGF+ F + L Sbjct: 61 SLWIGDLQQWMDENYIMSVFAQSGEAT-SAKVIRNKLTGQSEGYGFIEFVSHSVAERVLQ 119 Query: 238 AMNG 249 NG Sbjct: 120 TYNG 123 >At4g27000.1 68417.m03884 RNA-binding protein 45 (RBP45), putative DNA binding protein ACBF - Nicotiana tabacum, PID:g1899188 Length = 415 Score = 79.8 bits (188), Expect = 6e-16 Identities = 47/103 (45%), Positives = 63/103 (61%), Gaps = 3/103 (2%) Frame = +1 Query: 1 FRLNTASRETRANMQHER-EFSVWVGDLSPDVDDYSLYRVFASKYTSIKTAKVILD-NSG 174 FRLN A Q E E +V+VGDL+PDV D+ L F + Y+S+K AKV+ D +G Sbjct: 153 FRLNWAQLGAGERRQAEGPEHTVFVGDLAPDVTDHMLTETFKAVYSSVKGAKVVNDRTTG 212 Query: 175 YTKGYGFVRFGNEDEQRNALYAMNG-YCGLGTKPLKICTAVPK 300 +KGYGFVRF +E EQ A+ MNG YC ++P++ A K Sbjct: 213 RSKGYGFVRFADESEQIRAMTEMNGQYC--SSRPMRTGPAANK 253 Score = 46.8 bits (106), Expect = 6e-06 Identities = 25/65 (38%), Positives = 35/65 (53%), Gaps = 2/65 (3%) Frame = +1 Query: 61 SVWVGDLSPDVDDYSLYRVFASKYTSIKTAKVILDN--SGYTKGYGFVRFGNEDEQRNAL 234 S+W+GDL P +D+ L VF T TA ++ N +GY++GYGF+ F N L Sbjct: 81 SLWIGDLQPWMDENYLMNVFG--LTGEATAAKVIRNKQNGYSEGYGFIEFVNHATAERNL 138 Query: 235 YAMNG 249 NG Sbjct: 139 QTYNG 143 >At3g14100.1 68416.m01782 oligouridylate-binding protein, putative similar to GB:CAB75429 (GI:6996560) from [Nicotiana plumbaginifolia], contains Pfam profiles: PF00076 RNA recognition motif (3 copies) Length = 427 Score = 58.4 bits (135), Expect = 2e-09 Identities = 28/65 (43%), Positives = 46/65 (70%), Gaps = 1/65 (1%) Frame = +1 Query: 58 FSVWVGDLSPDVDDYSLYRVFASKYTSIKTAKVILD-NSGYTKGYGFVRFGNEDEQRNAL 234 F+++VGDLSP+V D +LY+ F S ++S A+V+ D +G ++G+GFV F N+ + + A+ Sbjct: 144 FNIFVGDLSPEVTDATLYQSF-SVFSSCSDARVMWDQKTGRSRGFGFVSFRNQQDAQTAI 202 Query: 235 YAMNG 249 MNG Sbjct: 203 NEMNG 207 Score = 33.9 bits (74), Expect = 0.042 Identities = 31/98 (31%), Positives = 48/98 (48%), Gaps = 1/98 (1%) Frame = +1 Query: 13 TASRETRANMQHEREFSVWVGDLSPDVDDYSLYRVF-ASKYTSIKTAKVILDNSGYTKGY 189 T + ET N + + +V+VG+L+P+V L+R F A I+ +V D KG+ Sbjct: 252 TLNEETPEN--NSQFTTVYVGNLAPEVTQLDLHRYFHALGAGVIEEVRVQRD-----KGF 304 Query: 190 GFVRFGNEDEQRNALYAMNGYCGLGTKPLKICTAVPKP 303 GFVR+ E A+ N L + +K C+ KP Sbjct: 305 GFVRYNTHPEAALAIQMGNTQPYLFNRQIK-CSWGNKP 341 >At1g54080.1 68414.m06162 oligouridylate-binding protein, putative similar to oligouridylate binding protein GI:6996560 from [Nicotiana plumbaginifolia] Length = 426 Score = 55.6 bits (128), Expect = 1e-08 Identities = 27/65 (41%), Positives = 44/65 (67%), Gaps = 1/65 (1%) Frame = +1 Query: 58 FSVWVGDLSPDVDDYSLYRVFASKYTSIKTAKVILDN-SGYTKGYGFVRFGNEDEQRNAL 234 F+++VGDLSP+V D +L+ F S + S A+V+ D +G ++G+GFV F N+ + + A+ Sbjct: 148 FNIFVGDLSPEVTDAALFDSF-SAFNSCSDARVMWDQKTGRSRGFGFVSFRNQQDAQTAI 206 Query: 235 YAMNG 249 MNG Sbjct: 207 NEMNG 211 Score = 37.9 bits (84), Expect = 0.003 Identities = 27/82 (32%), Positives = 44/82 (53%), Gaps = 1/82 (1%) Frame = +1 Query: 61 SVWVGDLSPDVDDYSLYRVFASKYTS-IKTAKVILDNSGYTKGYGFVRFGNEDEQRNALY 237 +V+VG+LSP+V L+R+F + I+ +V D KG+GFVR+ DE A+ Sbjct: 270 TVYVGNLSPEVTQLDLHRLFYTLGAGVIEEVRVQRD-----KGFGFVRYNTHDEAALAIQ 324 Query: 238 AMNGYCGLGTKPLKICTAVPKP 303 N L ++ ++ C+ KP Sbjct: 325 MGNAQPFLFSRQIR-CSWGNKP 345 >At1g22760.1 68414.m02844 polyadenylate-binding protein 3 (PABP3) Length = 660 Score = 55.6 bits (128), Expect = 1e-08 Identities = 30/80 (37%), Positives = 49/80 (61%) Frame = +1 Query: 61 SVWVGDLSPDVDDYSLYRVFASKYTSIKTAKVILDNSGYTKGYGFVRFGNEDEQRNALYA 240 ++++ +L VDD L +F S+Y ++ ++KV+L+ G ++G+GFV + N +E AL Sbjct: 333 NLYLKNLDDSVDDEKLKEMF-SEYGNVTSSKVMLNPQGMSRGFGFVAYSNPEEALRALSE 391 Query: 241 MNGYCGLGTKPLKICTAVPK 300 MNG +G KPL I A K Sbjct: 392 MNGKM-IGRKPLYIALAQRK 410 Score = 48.4 bits (110), Expect = 2e-06 Identities = 21/63 (33%), Positives = 42/63 (66%) Frame = +1 Query: 61 SVWVGDLSPDVDDYSLYRVFASKYTSIKTAKVILDNSGYTKGYGFVRFGNEDEQRNALYA 240 ++++ +L +D+ +L+ F+S + +I + KV +D +G +KGYGFV+F E+ + A+ Sbjct: 137 NIFIKNLDASIDNKALFETFSS-FGTILSCKVAMDVTGRSKGYGFVQFEKEESAQAAIDK 195 Query: 241 MNG 249 +NG Sbjct: 196 LNG 198 Score = 44.0 bits (99), Expect = 4e-05 Identities = 23/85 (27%), Positives = 45/85 (52%) Frame = +1 Query: 61 SVWVGDLSPDVDDYSLYRVFASKYTSIKTAKVILDNSGYTKGYGFVRFGNEDEQRNALYA 240 S++ GDL P V + L+ +F ++ + +V D + + GY ++ F N ++ A+ A Sbjct: 50 SLYAGDLDPKVTEAHLFDLF-KHVANVVSVRVCRDQNRRSLGYAYINFSNPNDAYRAMEA 108 Query: 241 MNGYCGLGTKPLKICTAVPKPKSNL 315 +N Y L +P++I + P + L Sbjct: 109 LN-YTPLFDRPIRIMLSNRDPSTRL 132 Score = 37.1 bits (82), Expect = 0.005 Identities = 27/88 (30%), Positives = 44/88 (50%) Frame = +1 Query: 37 NMQHEREFSVWVGDLSPDVDDYSLYRVFASKYTSIKTAKVILDNSGYTKGYGFVRFGNED 216 N R +V+V +L ++ + L + F K+ I +A V+ D SG ++ +GFV F + Sbjct: 222 NTPTPRFTNVYVKNLPKEIGEDELRKTFG-KFGVISSAVVMRDQSGNSRCFGFVNFECTE 280 Query: 217 EQRNALYAMNGYCGLGTKPLKICTAVPK 300 +A+ MNG LG L + A K Sbjct: 281 AAASAVEKMNG-ISLGDDVLYVGRAQKK 307 >At3g04500.1 68416.m00477 RNA recognition motif (RRM)-containing protein similar to ssRNA-binding protein [Dictyostelium discoideum] GI:1546894; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 245 Score = 54.8 bits (126), Expect = 2e-08 Identities = 32/79 (40%), Positives = 48/79 (60%), Gaps = 1/79 (1%) Frame = +1 Query: 49 EREFSVWVGDLSPDVDDYSLYRVFASKYTSIKTAKVILDN-SGYTKGYGFVRFGNEDEQR 225 E ++ ++ GDL +V+D L + FA ++ + AKVI D +G TKGYGFV F N + Sbjct: 134 ENDYRLFCGDLGNEVNDDVLSKAFA-RFPTFNMAKVIRDKRTGKTKGYGFVSFLNPADLA 192 Query: 226 NALYAMNGYCGLGTKPLKI 282 AL MNG +G +P+K+ Sbjct: 193 AALKEMNGKY-VGNRPIKL 210 >At1g34140.1 68414.m04235 polyadenylate-binding protein, putative / PABP, putative non-consensus splice donor TA at exon 1; similar to polyadenylate-binding protein (poly(A)-binding protein) from [Triticum aestivum] GI:1737492, [Nicotiana tabacum] GI:7673355, {Arabidopsis thaliana} SP|P42731; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 407 Score = 53.2 bits (122), Expect = 6e-08 Identities = 29/93 (31%), Positives = 53/93 (56%) Frame = +1 Query: 37 NMQHEREFSVWVGDLSPDVDDYSLYRVFASKYTSIKTAKVILDNSGYTKGYGFVRFGNED 216 +M+ + +++V +L VD+ L +F S++ +I + KV++ ++G +KG GFV F + Sbjct: 216 DMKTRKGMNLYVKNLDDSVDNTKLEELF-SEFGTITSCKVMVHSNGISKGVGFVEFSTSE 274 Query: 217 EQRNALYAMNGYCGLGTKPLKICTAVPKPKSNL 315 E A+ MNG +G KP+ + A K + L Sbjct: 275 EASKAMLKMNGKM-VGNKPIYVSLAQCKEQHKL 306 Score = 37.9 bits (84), Expect = 0.003 Identities = 22/63 (34%), Positives = 35/63 (55%) Frame = +1 Query: 61 SVWVGDLSPDVDDYSLYRVFASKYTSIKTAKVILDNSGYTKGYGFVRFGNEDEQRNALYA 240 +V+V +L +D+ L +F S + + + KV D SG +KGYGFV+F ++ A Sbjct: 32 NVFVKNLDESIDNKQLCDMF-SAFGKVLSCKVARDASGVSKGYGFVQFYSDLSVYTACNF 90 Query: 241 MNG 249 NG Sbjct: 91 HNG 93 Score = 35.9 bits (79), Expect = 0.010 Identities = 23/75 (30%), Positives = 37/75 (49%), Gaps = 1/75 (1%) Frame = +1 Query: 28 TRANMQHEREFS-VWVGDLSPDVDDYSLYRVFASKYTSIKTAKVILDNSGYTKGYGFVRF 204 +R R F+ V+V +L D L R+F ++ I +A V+ D G ++ +GFV F Sbjct: 108 SRGQWDKSRVFTNVYVKNLVETATDADLKRLFG-EFGEITSAVVMKDGEGKSRRFGFVNF 166 Query: 205 GNEDEQRNALYAMNG 249 + A+ MNG Sbjct: 167 EKAEAAVTAIEKMNG 181 >At5g51300.2 68418.m06360 splicing factor-related contains similarity to SF1 protein [Drosophila melanogaster] GI:6687400 Length = 804 Score = 52.8 bits (121), Expect = 9e-08 Identities = 34/97 (35%), Positives = 53/97 (54%), Gaps = 2/97 (2%) Frame = +1 Query: 19 SRETRANMQHEREFSVWVGDLSPDVDDYSLYRVFASKYTSIKTAKVILDN-SGYTKGYGF 195 S T+ + E ++++G L P ++D L +F+S + I AKVI D +G +KGYGF Sbjct: 467 STPTKPPSKEYDETNLYIGFLPPMLEDDGLINLFSS-FGEIVMAKVIKDRVTGLSKGYGF 525 Query: 196 VRFGNEDEQRNALYAMNGYCGLG-TKPLKICTAVPKP 303 V++ + A+ AMNGY G T ++I P P Sbjct: 526 VKYADVQMANTAVQAMNGYRFEGRTLAVRIAGKSPPP 562 >At5g51300.1 68418.m06359 splicing factor-related contains similarity to SF1 protein [Drosophila melanogaster] GI:6687400 Length = 804 Score = 52.8 bits (121), Expect = 9e-08 Identities = 34/97 (35%), Positives = 53/97 (54%), Gaps = 2/97 (2%) Frame = +1 Query: 19 SRETRANMQHEREFSVWVGDLSPDVDDYSLYRVFASKYTSIKTAKVILDN-SGYTKGYGF 195 S T+ + E ++++G L P ++D L +F+S + I AKVI D +G +KGYGF Sbjct: 467 STPTKPPSKEYDETNLYIGFLPPMLEDDGLINLFSS-FGEIVMAKVIKDRVTGLSKGYGF 525 Query: 196 VRFGNEDEQRNALYAMNGYCGLG-TKPLKICTAVPKP 303 V++ + A+ AMNGY G T ++I P P Sbjct: 526 VKYADVQMANTAVQAMNGYRFEGRTLAVRIAGKSPPP 562 >At4g24770.1 68417.m03546 31 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein RNP-T, putative / RNA-binding protein 1/2/3, putative / RNA-binding protein cp31, putative similar to SP|Q04836 31 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein RNP-T) (RNA-binding protein 1/2/3) (AtRBP33) (RNA-binding protein cp31) {Arabidopsis thaliana}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 329 Score = 52.4 bits (120), Expect = 1e-07 Identities = 32/96 (33%), Positives = 56/96 (58%), Gaps = 1/96 (1%) Frame = +1 Query: 19 SRETRANMQHEREFSVWVGDLSPDVDDYSLYRVFASKYTSIKTAKVILDN-SGYTKGYGF 195 SR RA +E F V+VG+L DVD+ L ++F S++ + A+V+ D +G ++G+GF Sbjct: 231 SRPERAPRVYEPAFRVYVGNLPWDVDNGRLEQLF-SEHGKVVEARVVYDRETGRSRGFGF 289 Query: 196 VRFGNEDEQRNALYAMNGYCGLGTKPLKICTAVPKP 303 V + DE A+ A++G L + +++ A +P Sbjct: 290 VTMSDVDELNEAISALDGQ-NLEGRAIRVNVAEERP 324 >At5g47320.1 68418.m05833 30S ribosomal protein S19, mitochondrial (RPS19) Length = 212 Score = 52.0 bits (119), Expect = 1e-07 Identities = 25/63 (39%), Positives = 42/63 (66%), Gaps = 1/63 (1%) Frame = +1 Query: 64 VWVGDLSPDVDDYSLYRVFASKYTSIKTAKVILDN-SGYTKGYGFVRFGNEDEQRNALYA 240 +++G LSP D++SL F+S + + A+V+ + +G ++GYGFV F +ED +A+ A Sbjct: 33 LYIGGLSPGTDEHSLKDAFSS-FNGVTEARVMTNKVTGRSRGYGFVNFISEDSANSAISA 91 Query: 241 MNG 249 MNG Sbjct: 92 MNG 94 >At5g50250.1 68418.m06223 31 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein RNP-T, putative / RNA-binding protein 1/2/3, putative / RNA-binding protein cp31, putative similar to SP|Q04836 31 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein RNP-T) (1/2/3) (AtRBP33) (cp31) {Arabidopsis thaliana}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 289 Score = 51.2 bits (117), Expect = 3e-07 Identities = 28/78 (35%), Positives = 48/78 (61%), Gaps = 1/78 (1%) Frame = +1 Query: 19 SRETRANMQHEREFSVWVGDLSPDVDDYSLYRVFASKYTSIKTAKVILDN-SGYTKGYGF 195 SR R ++ F ++VG+L DVD L R+F S++ + A+V+ D +G ++G+GF Sbjct: 194 SRPERQPRVYDAAFRIYVGNLPWDVDSGRLERLF-SEHGKVVDARVVSDRETGRSRGFGF 252 Query: 196 VRFGNEDEQRNALYAMNG 249 V+ NE+E A+ A++G Sbjct: 253 VQMSNENEVNVAIAALDG 270 Score = 33.9 bits (74), Expect = 0.042 Identities = 22/83 (26%), Positives = 44/83 (53%), Gaps = 1/83 (1%) Frame = +1 Query: 55 EFSVWVGDLSPDVDDYSLYRVFASKYTSIKTAKVILD-NSGYTKGYGFVRFGNEDEQRNA 231 E ++VG+L DVD +L +F T ++ ++VI + ++ ++G+GFV +E A Sbjct: 112 EAKLFVGNLPYDVDSQALAMLFEQAGT-VEISEVIYNRDTDQSRGFGFVTMSTVEEAEKA 170 Query: 232 LYAMNGYCGLGTKPLKICTAVPK 300 + N + + + L + A P+ Sbjct: 171 VEKFNSF-EVNGRRLTVNRAAPR 192 >At1g71770.1 68414.m08295 polyadenylate-binding protein 5 (PABP5) identical to GB:Q05196 from [Arabidopsis thaliana] Length = 668 Score = 51.2 bits (117), Expect = 3e-07 Identities = 26/80 (32%), Positives = 49/80 (61%) Frame = +1 Query: 61 SVWVGDLSPDVDDYSLYRVFASKYTSIKTAKVILDNSGYTKGYGFVRFGNEDEQRNALYA 240 ++++ +L V+D L +F S+Y ++ + KV++++ G ++G+GFV + N +E A+ Sbjct: 329 NLYLKNLDDSVNDEKLKEMF-SEYGNVTSCKVMMNSQGLSRGFGFVAYSNPEEALLAMKE 387 Query: 241 MNGYCGLGTKPLKICTAVPK 300 MNG +G KPL + A K Sbjct: 388 MNGKM-IGRKPLYVALAQRK 406 Score = 48.8 bits (111), Expect = 1e-06 Identities = 23/63 (36%), Positives = 41/63 (65%) Frame = +1 Query: 61 SVWVGDLSPDVDDYSLYRVFASKYTSIKTAKVILDNSGYTKGYGFVRFGNEDEQRNALYA 240 +V++ +L +D+ +LY F+S + +I + KV +D G +KGYGFV+F E+ + A+ Sbjct: 133 NVFIKNLDASIDNKALYETFSS-FGTILSCKVAMDVVGRSKGYGFVQFEKEETAQAAIDK 191 Query: 241 MNG 249 +NG Sbjct: 192 LNG 194 Score = 44.4 bits (100), Expect = 3e-05 Identities = 24/92 (26%), Positives = 48/92 (52%) Frame = +1 Query: 40 MQHEREFSVWVGDLSPDVDDYSLYRVFASKYTSIKTAKVILDNSGYTKGYGFVRFGNEDE 219 +Q S++VGDL P V++ L +F ++ + +V D + + GY +V F N ++ Sbjct: 39 LQTHPNSSLYVGDLDPSVNESHLLDLF-NQVAPVHNLRVCRDLTHRSLGYAYVNFANPED 97 Query: 220 QRNALYAMNGYCGLGTKPLKICTAVPKPKSNL 315 A+ ++N Y + +P++I + P + L Sbjct: 98 ASRAMESLN-YAPIRDRPIRIMLSNRDPSTRL 128 Score = 41.5 bits (93), Expect = 2e-04 Identities = 27/80 (33%), Positives = 42/80 (52%) Frame = +1 Query: 61 SVWVGDLSPDVDDYSLYRVFASKYTSIKTAKVILDNSGYTKGYGFVRFGNEDEQRNALYA 240 +V+V +L ++ D L + F KY I +A V+ D SG ++ +GFV F + + A+ Sbjct: 226 NVYVKNLPKEITDDELKKTFG-KYGDISSAVVMKDQSGNSRSFGFVNFVSPEAAAVAVEK 284 Query: 241 MNGYCGLGTKPLKICTAVPK 300 MNG LG L + A K Sbjct: 285 MNG-ISLGEDVLYVGRAQKK 303 >At1g17370.1 68414.m02118 oligouridylate-binding protein, putative similar to oligouridylate binding protein [Nicotiana plumbaginifolia] GI:6996560; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 419 Score = 51.2 bits (117), Expect = 3e-07 Identities = 27/75 (36%), Positives = 48/75 (64%), Gaps = 1/75 (1%) Frame = +1 Query: 58 FSVWVGDLSPDVDDYSLYRVFASKYTSIKTAKVILD-NSGYTKGYGFVRFGNEDEQRNAL 234 F+++VGDLSP+V D L+ F S Y + A+V+ D +G ++G+GFV F N+ + + A+ Sbjct: 139 FNIFVGDLSPEVTDAMLFTCF-SVYPTCSDARVMWDQKTGRSRGFGFVSFRNQQDAQTAI 197 Query: 235 YAMNGYCGLGTKPLK 279 + G LG++ ++ Sbjct: 198 DEITGK-WLGSRQIR 211 Score = 35.9 bits (79), Expect = 0.010 Identities = 27/82 (32%), Positives = 42/82 (51%), Gaps = 1/82 (1%) Frame = +1 Query: 61 SVWVGDLSPDVDDYSLYRVFASKYTS-IKTAKVILDNSGYTKGYGFVRFGNEDEQRNALY 237 +V+VG+L+P+V L+R F S I+ +V D KG+GFVR+ E A+ Sbjct: 261 TVYVGNLAPEVSQVDLHRHFHSLGAGVIEEVRVQRD-----KGFGFVRYSTHVEAALAIQ 315 Query: 238 AMNGYCGLGTKPLKICTAVPKP 303 N + L + +K C+ KP Sbjct: 316 MGNTHSYLSGRQMK-CSWGSKP 336 >At2g23350.1 68415.m02788 polyadenylate-binding protein, putative / PABP, putative Length = 662 Score = 50.8 bits (116), Expect = 3e-07 Identities = 28/82 (34%), Positives = 49/82 (59%) Frame = +1 Query: 4 RLNTASRETRANMQHEREFSVWVGDLSPDVDDYSLYRVFASKYTSIKTAKVILDNSGYTK 183 R+ +SR++ A + +++V +L VD+ +L+ F+ T I + KV D+ G ++ Sbjct: 118 RITYSSRDSSA--RRSGVGNLFVKNLDKSVDNKTLHEAFSGCGT-IVSCKVATDHMGQSR 174 Query: 184 GYGFVRFGNEDEQRNALYAMNG 249 GYGFV+F ED +NA+ +NG Sbjct: 175 GYGFVQFDTEDSAKNAIEKLNG 196 Score = 46.8 bits (106), Expect = 6e-06 Identities = 30/80 (37%), Positives = 43/80 (53%) Frame = +1 Query: 61 SVWVGDLSPDVDDYSLYRVFASKYTSIKTAKVILDNSGYTKGYGFVRFGNEDEQRNALYA 240 +++V +L V D L +FA ++ +I + KV+ D SG +KG GFV F E L Sbjct: 329 NLYVKNLDDTVTDEKLRELFA-EFGTITSCKVMRDPSGTSKGSGFVAFSAASEASRVLNE 387 Query: 241 MNGYCGLGTKPLKICTAVPK 300 MNG +G KPL + A K Sbjct: 388 MNGKM-VGGKPLYVALAQRK 406 Score = 43.6 bits (98), Expect = 5e-05 Identities = 26/77 (33%), Positives = 43/77 (55%), Gaps = 1/77 (1%) Frame = +1 Query: 22 RETRANMQHEREFS-VWVGDLSPDVDDYSLYRVFASKYTSIKTAKVILDNSGYTKGYGFV 198 +E R + + +F+ V+V +LS D L F +Y SI +A V+ D G ++ +GFV Sbjct: 212 KEERESAADKMKFTNVYVKNLSEATTDDELKTTFG-QYGSISSAVVMRDGDGKSRCFGFV 270 Query: 199 RFGNEDEQRNALYAMNG 249 F N ++ A+ A+NG Sbjct: 271 NFENPEDAARAVEALNG 287 >At1g54080.2 68414.m06163 oligouridylate-binding protein, putative similar to oligouridylate binding protein GI:6996560 from [Nicotiana plumbaginifolia] Length = 430 Score = 50.4 bits (115), Expect = 5e-07 Identities = 26/68 (38%), Positives = 45/68 (66%), Gaps = 4/68 (5%) Frame = +1 Query: 58 FSVWVGDLSPDVDDYSLYRVFA---SKYTSIKTAKVILDN-SGYTKGYGFVRFGNEDEQR 225 F+++VGDLSP+V D +L+ F+ S + + A+V+ D +G ++G+GFV F N+ + + Sbjct: 148 FNIFVGDLSPEVTDAALFDSFSAFNSCSSYYRDARVMWDQKTGRSRGFGFVSFRNQQDAQ 207 Query: 226 NALYAMNG 249 A+ MNG Sbjct: 208 TAINEMNG 215 Score = 37.9 bits (84), Expect = 0.003 Identities = 27/82 (32%), Positives = 44/82 (53%), Gaps = 1/82 (1%) Frame = +1 Query: 61 SVWVGDLSPDVDDYSLYRVFASKYTS-IKTAKVILDNSGYTKGYGFVRFGNEDEQRNALY 237 +V+VG+LSP+V L+R+F + I+ +V D KG+GFVR+ DE A+ Sbjct: 274 TVYVGNLSPEVTQLDLHRLFYTLGAGVIEEVRVQRD-----KGFGFVRYNTHDEAALAIQ 328 Query: 238 AMNGYCGLGTKPLKICTAVPKP 303 N L ++ ++ C+ KP Sbjct: 329 MGNAQPFLFSRQIR-CSWGNKP 349 >At2g37220.1 68415.m04566 29 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein cp29, putative similar to SP|Q43349 29 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein cp29) {Arabidopsis thaliana} Length = 289 Score = 50.0 bits (114), Expect = 6e-07 Identities = 29/81 (35%), Positives = 51/81 (62%), Gaps = 1/81 (1%) Frame = +1 Query: 64 VWVGDLSPDVDDYSLYRVFASKYTSIKTAKVILD-NSGYTKGYGFVRFGNEDEQRNALYA 240 V+VG+LS VDD +L +F S+ + A+VI D +SG +KG+GFV + + E +NA+ + Sbjct: 206 VYVGNLSWGVDDMALESLF-SEQGKVVEARVIYDRDSGRSKGFGFVTYDSSQEVQNAIKS 264 Query: 241 MNGYCGLGTKPLKICTAVPKP 303 ++G L + +++ A +P Sbjct: 265 LDG-ADLDGRQIRVSEAEARP 284 Score = 44.4 bits (100), Expect = 3e-05 Identities = 27/85 (31%), Positives = 46/85 (54%), Gaps = 1/85 (1%) Frame = +1 Query: 55 EFSVWVGDLSPDVDDYSLYRVFASKYTSIKTAKVILDN-SGYTKGYGFVRFGNEDEQRNA 231 + ++VG+L +VD L ++F S +++ +VI D +G ++G+GFV + E A Sbjct: 90 DLKLFVGNLPFNVDSAQLAQLFESA-GNVEMVEVIYDKITGRSRGFGFVTMSSVSEVEAA 148 Query: 232 LYAMNGYCGLGTKPLKICTAVPKPK 306 NGY L +PL++ P PK Sbjct: 149 AQQFNGY-ELDGRPLRVNAGPPPPK 172 >At4g34110.1 68417.m04839 polyadenylate-binding protein 2 (PABP2) non-consensus TA donor splice site at exon 2, polyadenylate-binding protein - Triticum aestivum (common wheat),PIR:T06979 Length = 443 Score = 48.0 bits (109), Expect = 2e-06 Identities = 26/78 (33%), Positives = 45/78 (57%), Gaps = 1/78 (1%) Frame = +1 Query: 22 RETRANMQHEREFS-VWVGDLSPDVDDYSLYRVFASKYTSIKTAKVILDNSGYTKGYGFV 198 R+ R + ++ +F+ V+V +L+ D L F +Y I +A V+ D G +KG+GFV Sbjct: 16 RQERDSTANKTKFTNVYVKNLAESTTDDDLKNAFG-EYGKITSAVVMKDGEGKSKGFGFV 74 Query: 199 RFGNEDEQRNALYAMNGY 252 F N D+ A+ ++NG+ Sbjct: 75 NFENADDAARAVESLNGH 92 Score = 46.8 bits (106), Expect = 6e-06 Identities = 25/80 (31%), Positives = 46/80 (57%) Frame = +1 Query: 61 SVWVGDLSPDVDDYSLYRVFASKYTSIKTAKVILDNSGYTKGYGFVRFGNEDEQRNALYA 240 +++V +L P + D L +F S + ++ ++KV+ D +G +KG GFV F +E A+ Sbjct: 133 NLYVKNLDPSISDEKLKEIF-SPFGTVTSSKVMRDPNGTSKGSGFVAFATPEEATEAMSQ 191 Query: 241 MNGYCGLGTKPLKICTAVPK 300 ++G + +KPL + A K Sbjct: 192 LSGKM-IESKPLYVAIAQRK 210 >At4g39260.4 68417.m05560 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 105 Score = 47.2 bits (107), Expect = 4e-06 Identities = 28/73 (38%), Positives = 43/73 (58%), Gaps = 1/73 (1%) Frame = +1 Query: 49 EREFSVWVGDLSPDVDDYSLYRVFASKYTSIKTAKVILDN-SGYTKGYGFVRFGNEDEQR 225 E E+ +VG L+ +D L R F S++ + +K+I D SG ++G+GFV F +E R Sbjct: 3 EVEYRCFVGGLAWATNDEDLQRTF-SQFGDVIDSKIINDRESGRSRGFGFVTFKDEKAMR 61 Query: 226 NALYAMNGYCGLG 264 +A+ MNG G G Sbjct: 62 DAIEEMNGSGGGG 74 >At3g16380.1 68416.m02074 polyadenylate-binding protein, putative / PABP, putative similar to polyadenylate-binding protein (poly(A)-binding protein) from {Arabidopsis thaliana} SP|P42731, [Cucumis sativus] GI:7528270, {Homo sapiens} SP|Q13310, {Arabidopsis thaliana} SP|Q05196; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 537 Score = 47.2 bits (107), Expect = 4e-06 Identities = 33/97 (34%), Positives = 55/97 (56%), Gaps = 3/97 (3%) Frame = +1 Query: 19 SRETRANMQHEREFS-VWVGDLSPDVDDYSLYRVFASKYTSIKTAKVILDNSGYTKGYGF 195 +++ RA M ++ + V+V +L V D L+ +F S+Y ++ + V+ D G ++G+GF Sbjct: 188 NKDERAAMAGNQDSTNVYVKNLIETVTDDCLHTLF-SQYGTVSSVVVMRDGMGRSRGFGF 246 Query: 196 VRFGNEDEQRNALYAMNGYCG--LGTKPLKICTAVPK 300 V F N + NA AM CG LG+K L + A+ K Sbjct: 247 VNFCNPE---NAKKAMESLCGLQLGSKKLFVGKALKK 280 Score = 45.6 bits (103), Expect = 1e-05 Identities = 27/80 (33%), Positives = 46/80 (57%) Frame = +1 Query: 61 SVWVGDLSPDVDDYSLYRVFASKYTSIKTAKVILDNSGYTKGYGFVRFGNEDEQRNALYA 240 +++V +LS +++ L +F Y I +AKV+ +G +KG+GFV F N +E + A Sbjct: 305 NLYVKNLSESMNETRLREIFGC-YGQIVSAKVMCHENGRSKGFGFVCFSNCEESKQAKRY 363 Query: 241 MNGYCGLGTKPLKICTAVPK 300 +NG+ G KP+ + A K Sbjct: 364 LNGFLVDG-KPIVVRVAERK 382 Score = 38.3 bits (85), Expect = 0.002 Identities = 23/70 (32%), Positives = 39/70 (55%) Frame = +1 Query: 61 SVWVGDLSPDVDDYSLYRVFASKYTSIKTAKVILDNSGYTKGYGFVRFGNEDEQRNALYA 240 +++V +L + L R+F + SI + KV+ +N G +KG+GFV+F E +A A Sbjct: 113 NLYVKNLDSSITSSCLERMFCP-FGSILSCKVVEEN-GQSKGFGFVQFDTEQSAVSARSA 170 Query: 241 MNGYCGLGTK 270 ++G G K Sbjct: 171 LHGSMVYGKK 180 Score = 37.1 bits (82), Expect = 0.005 Identities = 27/89 (30%), Positives = 43/89 (48%), Gaps = 3/89 (3%) Frame = +1 Query: 25 ETRA--NMQHEREF-SVWVGDLSPDVDDYSLYRVFASKYTSIKTAKVILDNSGYTKGYGF 195 ET+A N QH F S++VGDLSPDV + L F+ + +G + Y + Sbjct: 7 ETQALGNHQHSSRFGSLYVGDLSPDVTEKDLIDKFSLNVPVVSVHLCRNSVTGKSMCYAY 66 Query: 196 VRFGNEDEQRNALYAMNGYCGLGTKPLKI 282 + F + NA+ +N + L K ++I Sbjct: 67 INFDSPFSASNAMTRLN-HSDLKGKAMRI 94 >At3g53460.2 68416.m05901 29 kDa ribonucleoprotein, chloroplast / RNA-binding protein cp 29 nearly identical to SP|Q43349 29 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein cp29) {Arabidopsis thaliana} Length = 334 Score = 46.8 bits (106), Expect = 6e-06 Identities = 27/81 (33%), Positives = 49/81 (60%), Gaps = 1/81 (1%) Frame = +1 Query: 64 VWVGDLSPDVDDYSLYRVFASKYTSIKTAKVILD-NSGYTKGYGFVRFGNEDEQRNALYA 240 ++VG+LS VDD +L +F ++ + A+VI D +SG +KG+GFV + E + A+ + Sbjct: 251 LYVGNLSWGVDDMALENLF-NEQGKVVEARVIYDRDSGRSKGFGFVTLSSSQEVQKAINS 309 Query: 241 MNGYCGLGTKPLKICTAVPKP 303 +NG L + +++ A +P Sbjct: 310 LNG-ADLDGRQIRVSEAEARP 329 Score = 44.4 bits (100), Expect = 3e-05 Identities = 28/85 (32%), Positives = 46/85 (54%), Gaps = 1/85 (1%) Frame = +1 Query: 55 EFSVWVGDLSPDVDDYSLYRVFASKYTSIKTAKVILDN-SGYTKGYGFVRFGNEDEQRNA 231 + ++VG+LS +VD L ++F S +++ +VI D +G ++G+GFV E A Sbjct: 98 DLKLFVGNLSFNVDSAQLAQLFESA-GNVEMVEVIYDKVTGRSRGFGFVTMSTAAEVEAA 156 Query: 232 LYAMNGYCGLGTKPLKICTAVPKPK 306 NGY G +PL++ P PK Sbjct: 157 AQQFNGYEFEG-RPLRVNAGPPPPK 180 >At3g53460.1 68416.m05900 29 kDa ribonucleoprotein, chloroplast / RNA-binding protein cp 29 nearly identical to SP|Q43349 29 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein cp29) {Arabidopsis thaliana} Length = 342 Score = 46.8 bits (106), Expect = 6e-06 Identities = 27/81 (33%), Positives = 49/81 (60%), Gaps = 1/81 (1%) Frame = +1 Query: 64 VWVGDLSPDVDDYSLYRVFASKYTSIKTAKVILD-NSGYTKGYGFVRFGNEDEQRNALYA 240 ++VG+LS VDD +L +F ++ + A+VI D +SG +KG+GFV + E + A+ + Sbjct: 259 LYVGNLSWGVDDMALENLF-NEQGKVVEARVIYDRDSGRSKGFGFVTLSSSQEVQKAINS 317 Query: 241 MNGYCGLGTKPLKICTAVPKP 303 +NG L + +++ A +P Sbjct: 318 LNG-ADLDGRQIRVSEAEARP 337 Score = 44.4 bits (100), Expect = 3e-05 Identities = 28/85 (32%), Positives = 46/85 (54%), Gaps = 1/85 (1%) Frame = +1 Query: 55 EFSVWVGDLSPDVDDYSLYRVFASKYTSIKTAKVILDN-SGYTKGYGFVRFGNEDEQRNA 231 + ++VG+LS +VD L ++F S +++ +VI D +G ++G+GFV E A Sbjct: 98 DLKLFVGNLSFNVDSAQLAQLFESA-GNVEMVEVIYDKVTGRSRGFGFVTMSTAAEVEAA 156 Query: 232 LYAMNGYCGLGTKPLKICTAVPKPK 306 NGY G +PL++ P PK Sbjct: 157 AQQFNGYEFEG-RPLRVNAGPPPPK 180 >At2g16260.1 68415.m01862 glycine-rich RNA-binding protein, putative similar to Glycine-rich RNA-binding protein from {Daucus carota} SP|Q03878, {Sinapis alba} SP|P49311, {Brassica napus} SP|Q05966, {Arabidopsis thaliana} SP|Q03251; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 185 Score = 46.8 bits (106), Expect = 6e-06 Identities = 24/68 (35%), Positives = 42/68 (61%), Gaps = 1/68 (1%) Frame = +1 Query: 49 EREFSVWVGDLSPDVDDYSLYRVFASKYTSIKTAKVILDN-SGYTKGYGFVRFGNEDEQR 225 + E+ +VG L+ D+ S+ R F +++ + +K+I+D +G +KG+ FV F +ED R Sbjct: 41 DNEYRCFVGGLAWATDEQSIERCF-NEFGEVFDSKIIIDRETGRSKGFRFVTFKDEDSMR 99 Query: 226 NALYAMNG 249 A+ MNG Sbjct: 100 TAIDRMNG 107 >At5g19960.1 68418.m02376 RNA recognition motif (RRM)-containing protein low similarity to glycine-rich RNA-binding protein [Euphorbia esula] GI:2645699; contains INTERPRO:IPR000504 RNA-binding region RNP-1 (RNA recognition motif) (RRM) domain Length = 337 Score = 46.0 bits (104), Expect = 1e-05 Identities = 26/63 (41%), Positives = 37/63 (58%) Frame = +1 Query: 61 SVWVGDLSPDVDDYSLYRVFASKYTSIKTAKVILDNSGYTKGYGFVRFGNEDEQRNALYA 240 SV+VG L D+ + ++ RVF S Y S+ T K++ D S K YGFV F N +A+ Sbjct: 8 SVYVGGLPYDITEEAVRRVF-SIYGSVLTVKIVNDRSVRGKCYGFVTFSNRRSADDAIED 66 Query: 241 MNG 249 M+G Sbjct: 67 MDG 69 >At4g39260.3 68417.m05559 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 92 Score = 46.0 bits (104), Expect = 1e-05 Identities = 26/68 (38%), Positives = 41/68 (60%), Gaps = 1/68 (1%) Frame = +1 Query: 49 EREFSVWVGDLSPDVDDYSLYRVFASKYTSIKTAKVILDN-SGYTKGYGFVRFGNEDEQR 225 E E+ +VG L+ +D L R F S++ + +K+I D SG ++G+GFV F +E R Sbjct: 3 EVEYRCFVGGLAWATNDEDLQRTF-SQFGDVIDSKIINDRESGRSRGFGFVTFKDEKAMR 61 Query: 226 NALYAMNG 249 +A+ MNG Sbjct: 62 DAIEEMNG 69 >At4g39260.2 68417.m05558 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 126 Score = 46.0 bits (104), Expect = 1e-05 Identities = 26/68 (38%), Positives = 41/68 (60%), Gaps = 1/68 (1%) Frame = +1 Query: 49 EREFSVWVGDLSPDVDDYSLYRVFASKYTSIKTAKVILDN-SGYTKGYGFVRFGNEDEQR 225 E E+ +VG L+ +D L R F S++ + +K+I D SG ++G+GFV F +E R Sbjct: 3 EVEYRCFVGGLAWATNDEDLQRTF-SQFGDVIDSKIINDRESGRSRGFGFVTFKDEKAMR 61 Query: 226 NALYAMNG 249 +A+ MNG Sbjct: 62 DAIEEMNG 69 >At4g39260.1 68417.m05557 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 169 Score = 46.0 bits (104), Expect = 1e-05 Identities = 26/68 (38%), Positives = 41/68 (60%), Gaps = 1/68 (1%) Frame = +1 Query: 49 EREFSVWVGDLSPDVDDYSLYRVFASKYTSIKTAKVILDN-SGYTKGYGFVRFGNEDEQR 225 E E+ +VG L+ +D L R F S++ + +K+I D SG ++G+GFV F +E R Sbjct: 3 EVEYRCFVGGLAWATNDEDLQRTF-SQFGDVIDSKIINDRESGRSRGFGFVTFKDEKAMR 61 Query: 226 NALYAMNG 249 +A+ MNG Sbjct: 62 DAIEEMNG 69 >At2g16940.1 68415.m01952 RNA recognition motif (RRM)-containing protein Length = 561 Score = 46.0 bits (104), Expect = 1e-05 Identities = 24/73 (32%), Positives = 45/73 (61%) Frame = +1 Query: 64 VWVGDLSPDVDDYSLYRVFASKYTSIKTAKVILDNSGYTKGYGFVRFGNEDEQRNALYAM 243 ++VG+L ++ + L +VF S + S++ +V D +G KG+GFV+F ++ RNAL + Sbjct: 287 LYVGNLHINMSEDDLRKVFES-FGSVELVQVPRDETGLCKGFGFVQFARLEDARNAL-NL 344 Query: 244 NGYCGLGTKPLKI 282 NG + + +K+ Sbjct: 345 NGQLEIAGRAIKV 357 >At5g54580.1 68418.m06794 RNA recognition motif (RRM)-containing protein low similarity to RNA-binding protein RGP-3 [Nicotiana sylvestris] GI:1009363; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 156 Score = 45.6 bits (103), Expect = 1e-05 Identities = 26/79 (32%), Positives = 41/79 (51%), Gaps = 1/79 (1%) Frame = +1 Query: 16 ASRETRANMQHEREFSVWVGDLSPDVDDYSLYRVFASKYTSIKTAKVILDN-SGYTKGYG 192 A +T A Q E +++V LS L FA ++ + AKV+ D SGY+KG+G Sbjct: 42 AESQTPARPQAEPSTNLFVSGLSKRTTSEGLRTAFA-QFGEVADAKVVTDRVSGYSKGFG 100 Query: 193 FVRFGNEDEQRNALYAMNG 249 FVR+ ++ + M+G Sbjct: 101 FVRYATLEDSAKGIAGMDG 119 >At3g26420.1 68416.m03295 glycine-rich RNA-binding protein similar to RNA-binding protein (RZ-1) GB:BAA12064 [Nicotiana sylvestris]; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 245 Score = 45.6 bits (103), Expect = 1e-05 Identities = 25/71 (35%), Positives = 38/71 (53%), Gaps = 1/71 (1%) Frame = +1 Query: 40 MQHEREFSVWVGDLSPDVDDYSLYRVFASKYTSIKTAKVILDN-SGYTKGYGFVRFGNED 216 M + E+ ++G L+ D L F KY + AKV+LD SG ++G+GF+ F + Sbjct: 1 MSEDPEYRCFIGGLAWTTSDRGLRDAF-EKYGHLVEAKVVLDKFSGRSRGFGFITFDEKK 59 Query: 217 EQRNALYAMNG 249 A+ AMNG Sbjct: 60 AMDEAIAAMNG 70 >At3g23830.2 68416.m02996 glycine-rich RNA-binding protein, putative similar to Glycine-rich RNA-binding protein 2, mitochondrial precursor (AtGRP2) (Swiss-Prot:Q9SVM8) [Arabidopsis thaliana]; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 136 Score = 45.6 bits (103), Expect = 1e-05 Identities = 26/63 (41%), Positives = 37/63 (58%), Gaps = 1/63 (1%) Frame = +1 Query: 64 VWVGDLSPDVDDYSLYRVFASKYTSIKTAKVILDN-SGYTKGYGFVRFGNEDEQRNALYA 240 ++VG LS DD SL + F S + + A VI D +G ++G+GFV F ED NA+ Sbjct: 37 LFVGGLSWGTDDSSLKQAFTS-FGEVTEATVIADRETGRSRGFGFVSFSCEDSANNAIKE 95 Query: 241 MNG 249 M+G Sbjct: 96 MDG 98 >At3g23830.1 68416.m02995 glycine-rich RNA-binding protein, putative similar to Glycine-rich RNA-binding protein 2, mitochondrial precursor (AtGRP2) (Swiss-Prot:Q9SVM8) [Arabidopsis thaliana]; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 136 Score = 45.6 bits (103), Expect = 1e-05 Identities = 26/63 (41%), Positives = 37/63 (58%), Gaps = 1/63 (1%) Frame = +1 Query: 64 VWVGDLSPDVDDYSLYRVFASKYTSIKTAKVILDN-SGYTKGYGFVRFGNEDEQRNALYA 240 ++VG LS DD SL + F S + + A VI D +G ++G+GFV F ED NA+ Sbjct: 37 LFVGGLSWGTDDSSLKQAFTS-FGEVTEATVIADRETGRSRGFGFVSFSCEDSANNAIKE 95 Query: 241 MNG 249 M+G Sbjct: 96 MDG 98 >At1g49760.1 68414.m05580 polyadenylate-binding protein, putative / PABP, putative similar to poly(A)-binding protein GB:AAF66825 GI:7673359 from [Nicotiana tabacum] Length = 671 Score = 45.6 bits (103), Expect = 1e-05 Identities = 20/63 (31%), Positives = 39/63 (61%) Frame = +1 Query: 61 SVWVGDLSPDVDDYSLYRVFASKYTSIKTAKVILDNSGYTKGYGFVRFGNEDEQRNALYA 240 ++++ +L +D +L+ F S + I + KV +D SG +KGYGFV++ ++ + A+ Sbjct: 134 NIFIKNLDKSIDHKALHETF-SAFGPILSCKVAVDPSGQSKGYGFVQYDTDEAAQGAIDK 192 Query: 241 MNG 249 +NG Sbjct: 193 LNG 195 Score = 45.6 bits (103), Expect = 1e-05 Identities = 29/80 (36%), Positives = 43/80 (53%) Frame = +1 Query: 61 SVWVGDLSPDVDDYSLYRVFASKYTSIKTAKVILDNSGYTKGYGFVRFGNEDEQRNALYA 240 +++V +L V D L FA + +I + KV+ D SG ++G GFV F +E A+ Sbjct: 328 NLYVKNLDESVTDDKLREHFAP-FGTITSCKVMRDPSGVSRGSGFVAFSTPEEATRAITE 386 Query: 241 MNGYCGLGTKPLKICTAVPK 300 MNG + TKPL + A K Sbjct: 387 MNGKM-IVTKPLYVALAQRK 405 Score = 45.2 bits (102), Expect = 2e-05 Identities = 25/64 (39%), Positives = 38/64 (59%), Gaps = 1/64 (1%) Frame = +1 Query: 61 SVWVGDLSPDVDDYSLYRVFASKYTSIKTAKVIL-DNSGYTKGYGFVRFGNEDEQRNALY 237 +V+V +LS + D L +VF + T+ VI+ D G +KG+GFV F N D+ A+ Sbjct: 225 NVYVKNLSESLSDEELNKVFGE--FGVTTSCVIMRDGEGKSKGFGFVNFENSDDAARAVD 282 Query: 238 AMNG 249 A+NG Sbjct: 283 ALNG 286 >At3g08000.1 68416.m00977 RNA-binding protein, putative similar to RNA-binding protein from [Nicotiana tabacum] GI:15822703, [Nicotiana sylvestris] GI:624925; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 143 Score = 44.8 bits (101), Expect = 2e-05 Identities = 28/80 (35%), Positives = 47/80 (58%), Gaps = 1/80 (1%) Frame = +1 Query: 64 VWVGDLSPDVDDYSLYRVFASKYTSIKTAKVILDN-SGYTKGYGFVRFGNEDEQRNALYA 240 +++G LS VD+ SL F+S + + ++ D SG ++G+GFV F E + +A A Sbjct: 43 LFIGGLSWSVDEQSLKDAFSS-FGEVAEVRIAYDKGSGRSRGFGFVDFAEEGDALSAKDA 101 Query: 241 MNGYCGLGTKPLKICTAVPK 300 M+G GL +PL+I A+ + Sbjct: 102 MDGK-GLLGRPLRISFALER 120 >At2g21660.2 68415.m02578 glycine-rich RNA-binding protein (GRP7) SP|Q03250 Glycine-rich RNA-binding protein 7 {Arabidopsis thaliana} Length = 159 Score = 44.4 bits (100), Expect = 3e-05 Identities = 24/66 (36%), Positives = 40/66 (60%), Gaps = 1/66 (1%) Frame = +1 Query: 55 EFSVWVGDLSPDVDDYSLYRVFASKYTSIKTAKVILDN-SGYTKGYGFVRFGNEDEQRNA 231 E+ +VG L+ DD +L FA +Y + +K+I D +G ++G+GFV F +E ++A Sbjct: 7 EYRCFVGGLAWATDDRALETAFA-QYGDVIDSKIINDRETGRSRGFGFVTFKDEKAMKDA 65 Query: 232 LYAMNG 249 + MNG Sbjct: 66 IEGMNG 71 >At2g21660.1 68415.m02577 glycine-rich RNA-binding protein (GRP7) SP|Q03250 Glycine-rich RNA-binding protein 7 {Arabidopsis thaliana} Length = 176 Score = 44.4 bits (100), Expect = 3e-05 Identities = 24/66 (36%), Positives = 40/66 (60%), Gaps = 1/66 (1%) Frame = +1 Query: 55 EFSVWVGDLSPDVDDYSLYRVFASKYTSIKTAKVILDN-SGYTKGYGFVRFGNEDEQRNA 231 E+ +VG L+ DD +L FA +Y + +K+I D +G ++G+GFV F +E ++A Sbjct: 7 EYRCFVGGLAWATDDRALETAFA-QYGDVIDSKIINDRETGRSRGFGFVTFKDEKAMKDA 65 Query: 232 LYAMNG 249 + MNG Sbjct: 66 IEGMNG 71 >At5g04280.1 68418.m00421 glycine-rich RNA-binding protein Length = 310 Score = 44.0 bits (99), Expect = 4e-05 Identities = 24/80 (30%), Positives = 46/80 (57%), Gaps = 1/80 (1%) Frame = +1 Query: 64 VWVGDLSPDVDDYSLYRVFASKYTSIKTAKVILD-NSGYTKGYGFVRFGNEDEQRNALYA 240 ++VG LSP+V D L R F S++ I +++L+ ++G ++G+GF+ F + ++ Sbjct: 9 IFVGGLSPEVTDRDLERAF-SRFGDILDCQIMLERDTGRSRGFGFITFADRRAMDESIRE 67 Query: 241 MNGYCGLGTKPLKICTAVPK 300 M+G G + + + A PK Sbjct: 68 MHGR-DFGDRVISVNRAEPK 86 >At3g46020.1 68416.m04979 RNA-binding protein, putative similar to Cold-inducible RNA-binding protein (Glycine-rich RNA-binding protein CIRP) from {Homo sapiens} SP|Q14011, {Rattus norvegicus} SP|Q61413,{Xenopus laevis}; SP|O93235; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 102 Score = 42.3 bits (95), Expect = 1e-04 Identities = 24/63 (38%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = +1 Query: 64 VWVGDLSPDVDDYSLYRVFASKYTSIKTAKVILDNSGYT-KGYGFVRFGNEDEQRNALYA 240 ++V LS D SL ++F S + IK A++I D+ KG+GF+ F +ED+ R AL + Sbjct: 9 LFVSRLSAYTTDQSLRQLF-SPFGQIKEARLIRDSETQRPKGFGFITFDSEDDARKALKS 67 Query: 241 MNG 249 ++G Sbjct: 68 LDG 70 >At3g11400.1 68416.m01390 eukaryotic translation initiation factor 3G / eIF3g nearly identical to eukaryotic translation initiation factor 3g [Arabidopsis thaliana] GI:12407751 Length = 294 Score = 42.3 bits (95), Expect = 1e-04 Identities = 26/84 (30%), Positives = 46/84 (54%), Gaps = 1/84 (1%) Frame = +1 Query: 55 EFSVWVGDLSPDVDDYSLYRVFASKYTSIKTAKVILDN-SGYTKGYGFVRFGNEDEQRNA 231 E SV V +LS D + L +F + ++ V +D +G ++G+GFV F + ++ + A Sbjct: 212 ENSVRVTNLSEDTREPDLMELF-HPFGAVTRVYVAIDQKTGVSRGFGFVNFVSREDAQRA 270 Query: 232 LYAMNGYCGLGTKPLKICTAVPKP 303 + +NGY G L++ A P+P Sbjct: 271 INKLNGY-GYDNLILRVEWATPRP 293 >At4g13850.2 68417.m02146 glycine-rich RNA-binding protein (GRP2) glycine-rich RNA binding protein 2 AtGRP2 [Arabidopsis thaliana] GI:2826811 Length = 153 Score = 41.5 bits (93), Expect = 2e-04 Identities = 24/63 (38%), Positives = 37/63 (58%), Gaps = 1/63 (1%) Frame = +1 Query: 64 VWVGDLSPDVDDYSLYRVFASKYTSIKTAKVILDN-SGYTKGYGFVRFGNEDEQRNALYA 240 +++G LS DD SL FA + + AKVI+D +G ++G+GFV F +E A+ Sbjct: 37 LFIGGLSWGTDDASLRDAFAH-FGDVVDAKVIVDRETGRSRGFGFVNFNDEGAATAAISE 95 Query: 241 MNG 249 M+G Sbjct: 96 MDG 98 >At4g13850.1 68417.m02145 glycine-rich RNA-binding protein (GRP2) glycine-rich RNA binding protein 2 AtGRP2 [Arabidopsis thaliana] GI:2826811 Length = 158 Score = 41.5 bits (93), Expect = 2e-04 Identities = 24/63 (38%), Positives = 37/63 (58%), Gaps = 1/63 (1%) Frame = +1 Query: 64 VWVGDLSPDVDDYSLYRVFASKYTSIKTAKVILDN-SGYTKGYGFVRFGNEDEQRNALYA 240 +++G LS DD SL FA + + AKVI+D +G ++G+GFV F +E A+ Sbjct: 37 LFIGGLSWGTDDASLRDAFAH-FGDVVDAKVIVDRETGRSRGFGFVNFNDEGAATAAISE 95 Query: 241 MNG 249 M+G Sbjct: 96 MDG 98 >At2g18510.1 68415.m02157 pre-mRNA splicing factor, putative similar to SP|Q15427 Splicing factor 3B subunit 4 (Spliceosome associated protein 49) (SAP 49) (SF3b50) (Pre-mRNA splicing factor SF3b 49 kDa subunit) {Homo sapiens}; contains Pfam profile PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 363 Score = 41.5 bits (93), Expect = 2e-04 Identities = 22/83 (26%), Positives = 49/83 (59%), Gaps = 1/83 (1%) Frame = +1 Query: 4 RLNTASRETRANMQHEREFSVWVGDLSPDVDDYSLYRVFASKYTSIKTAKVILD-NSGYT 180 R+N AS++ ++ + ++++G+L PDVD+ LY F++ K++ D ++G + Sbjct: 97 RVNKASQDKKSL---DVGANLFIGNLDPDVDEKLLYDTFSAFGVIASNPKIMRDPDTGNS 153 Query: 181 KGYGFVRFGNEDEQRNALYAMNG 249 +G+GF+ + + + A+ +M G Sbjct: 154 RGFGFISYDSFEASDAAIESMTG 176 >At1g18630.1 68414.m02322 glycine-rich RNA-binding protein, putative similar to glycine-rich RNA-binding protein from {Sorghum bicolor} SP|Q99070, GI:1778373 from [Pisum sativum]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 155 Score = 41.5 bits (93), Expect = 2e-04 Identities = 24/61 (39%), Positives = 35/61 (57%), Gaps = 1/61 (1%) Frame = +1 Query: 64 VWVGDLSPDVDDYSLYRVFASKYTSIKTAKVILDN-SGYTKGYGFVRFGNEDEQRNALYA 240 ++VG LSP D L F S + I A V+LD SG ++G+GFV + + + NA+ A Sbjct: 38 IFVGGLSPSTDVELLKEAFGS-FGKIVDAVVVLDRESGLSRGFGFVTYDSIEVANNAMQA 96 Query: 241 M 243 M Sbjct: 97 M 97 >At1g60000.1 68414.m06759 29 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein cp29, putative similar to 29 kDa ribonucleoprotein chloroplast precursor {Nicotiana sylvestris} SP|Q08935, SP|Q08937; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) contains an AG-donor site at intron. Length = 258 Score = 39.9 bits (89), Expect = 6e-04 Identities = 23/69 (33%), Positives = 41/69 (59%), Gaps = 1/69 (1%) Frame = +1 Query: 49 EREFSVWVGDLSPDVDDYSLYRVFASKYTSIKTAKVILD-NSGYTKGYGFVRFGNEDEQR 225 E E ++VG+LS V SL F + + A+V+ D ++G ++GYGFV + ++ E Sbjct: 174 ETEHKLFVGNLSWTVTSESLAGAFR-ECGDVVGARVVFDGDTGRSRGYGFVCYSSKAEME 232 Query: 226 NALYAMNGY 252 AL +++G+ Sbjct: 233 TALESLDGF 241 >At5g06210.1 68418.m00693 RNA-binding protein, putative contains similarity to RNA-binding protein from [Nicotiana tabacum] GI:15822703, [Nicotiana sylvestris] GI:624925, [Solanum tuberosum] GI:15822705; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 146 Score = 39.1 bits (87), Expect = 0.001 Identities = 22/63 (34%), Positives = 35/63 (55%), Gaps = 1/63 (1%) Frame = +1 Query: 64 VWVGDLSPDVDDYSLYRVFASKYTSIKTAKVILDN-SGYTKGYGFVRFGNEDEQRNALYA 240 +++G LS + L F SK + A++++D S +KG+GFV F + DE + AL Sbjct: 36 LFIGGLSFCTTEQGLSEAF-SKCGQVVEAQIVMDRVSDRSKGFGFVTFASADEAQKALME 94 Query: 241 MNG 249 NG Sbjct: 95 FNG 97 >At1g03457.2 68414.m00327 RNA-binding protein, putative similar to Etr-1 [Danio rerio] GI:7670536, BRUNO-like 6 RNA-binding protein [Homo sapiens] GI:15341327; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 438 Score = 39.1 bits (87), Expect = 0.001 Identities = 21/75 (28%), Positives = 43/75 (57%), Gaps = 1/75 (1%) Frame = +1 Query: 61 SVWVGDLSPDVDDYSLYRVFASKYTSIKTAKVILDNS-GYTKGYGFVRFGNEDEQRNALY 237 ++++ ++ + +D L F + + +AKV +D + G +K +GF+ + ++ +NA+ Sbjct: 340 NLFIYNIPREFEDQELAATF-QPFGKVLSAKVFVDKATGISKCFGFISYDSQAAAQNAIN 398 Query: 238 AMNGYCGLGTKPLKI 282 MNG C L K LK+ Sbjct: 399 TMNG-CQLSGKKLKV 412 Score = 31.9 bits (69), Expect = 0.17 Identities = 17/65 (26%), Positives = 39/65 (60%) Frame = +1 Query: 55 EFSVWVGDLSPDVDDYSLYRVFASKYTSIKTAKVILDNSGYTKGYGFVRFGNEDEQRNAL 234 E ++VG L +V + + +F S+Y +IK +++ + +KG F+++ ++++ A+ Sbjct: 108 EHKLFVGMLPKNVSETEVQSLF-SEYGTIKDLQILRGSLQTSKGCLFLKYESKEQAVAAM 166 Query: 235 YAMNG 249 A+NG Sbjct: 167 EALNG 171 >At1g03457.1 68414.m00326 RNA-binding protein, putative similar to Etr-1 [Danio rerio] GI:7670536, BRUNO-like 6 RNA-binding protein [Homo sapiens] GI:15341327; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 429 Score = 39.1 bits (87), Expect = 0.001 Identities = 21/75 (28%), Positives = 43/75 (57%), Gaps = 1/75 (1%) Frame = +1 Query: 61 SVWVGDLSPDVDDYSLYRVFASKYTSIKTAKVILDNS-GYTKGYGFVRFGNEDEQRNALY 237 ++++ ++ + +D L F + + +AKV +D + G +K +GF+ + ++ +NA+ Sbjct: 331 NLFIYNIPREFEDQELAATF-QPFGKVLSAKVFVDKATGISKCFGFISYDSQAAAQNAIN 389 Query: 238 AMNGYCGLGTKPLKI 282 MNG C L K LK+ Sbjct: 390 TMNG-CQLSGKKLKV 403 Score = 31.9 bits (69), Expect = 0.17 Identities = 17/65 (26%), Positives = 39/65 (60%) Frame = +1 Query: 55 EFSVWVGDLSPDVDDYSLYRVFASKYTSIKTAKVILDNSGYTKGYGFVRFGNEDEQRNAL 234 E ++VG L +V + + +F S+Y +IK +++ + +KG F+++ ++++ A+ Sbjct: 99 EHKLFVGMLPKNVSETEVQSLF-SEYGTIKDLQILRGSLQTSKGCLFLKYESKEQAVAAM 157 Query: 235 YAMNG 249 A+NG Sbjct: 158 EALNG 162 >At2g36660.1 68415.m04496 polyadenylate-binding protein, putative / PABP, putative Length = 609 Score = 37.9 bits (84), Expect = 0.003 Identities = 24/80 (30%), Positives = 44/80 (55%) Frame = +1 Query: 61 SVWVGDLSPDVDDYSLYRVFASKYTSIKTAKVILDNSGYTKGYGFVRFGNEDEQRNALYA 240 +++V +++ V + L + F S+ +I + K++ D G +KG+GFV F +E +A+ Sbjct: 305 NIYVKNVNVAVTEEELRKHF-SQCGTITSTKLMCDEKGKSKGFGFVCFSTPEEAIDAVKT 363 Query: 241 MNGYCGLGTKPLKICTAVPK 300 +G G KPL + A K Sbjct: 364 FHGQMFHG-KPLYVAIAQKK 382 Score = 37.1 bits (82), Expect = 0.005 Identities = 21/62 (33%), Positives = 34/62 (54%) Frame = +1 Query: 61 SVWVGDLSPDVDDYSLYRVFASKYTSIKTAKVILDNSGYTKGYGFVRFGNEDEQRNALYA 240 +V+V +L V + L +F K+ +I + KV G ++GYGFV+F ED A+ Sbjct: 113 NVFVKNLPESVTNAVLQDMF-KKFGNIVSCKVATLEDGKSRGYGFVQFEQEDAAHAAIQT 171 Query: 241 MN 246 +N Sbjct: 172 LN 173 Score = 36.7 bits (81), Expect = 0.006 Identities = 24/84 (28%), Positives = 42/84 (50%) Frame = +1 Query: 49 EREFSVWVGDLSPDVDDYSLYRVFASKYTSIKTAKVILDNSGYTKGYGFVRFGNEDEQRN 228 E+ ++++ +L DV + L FA ++ I + + D + +GY FV F N ++ R Sbjct: 198 EKYTNLYMKNLDADVSEDLLREKFA-EFGKIVSLAIAKDENRLCRGYAFVNFDNPEDARR 256 Query: 229 ALYAMNGYCGLGTKPLKICTAVPK 300 A +NG G+K L + A K Sbjct: 257 AAETVNG-TKFGSKCLYVGRAQKK 279 >At1g20880.1 68414.m02615 RNA recognition motif (RRM)-containing protein similar to RRM-containing protein SEB-4 [Xenopus laevis] GI:8895698; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); is the location of EST 197B1T7 , gb|AA597386 Length = 274 Score = 37.9 bits (84), Expect = 0.003 Identities = 24/57 (42%), Positives = 33/57 (57%), Gaps = 1/57 (1%) Frame = +1 Query: 64 VWVGDLSPDVDDYSLYRVFASKYTSIKTAKVILD-NSGYTKGYGFVRFGNEDEQRNA 231 V+VG L+ + +L R F +Y I A VI D N+G +KGYGFV F + + R A Sbjct: 26 VFVGGLAWETQSETLRRHF-DQYGDILEAVVITDKNTGRSKGYGFVTFRDPEAARRA 81 >At4g36960.1 68417.m05238 RNA recognition motif (RRM)-containing protein similar to SP|P48809 Heterogeneous nuclear ribonucleoprotein 27C (hnRNP 48) {Drosophila melanogaster}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); non-consensus TA donor splice site at exon 6 Length = 379 Score = 37.5 bits (83), Expect = 0.003 Identities = 23/72 (31%), Positives = 41/72 (56%), Gaps = 1/72 (1%) Frame = +1 Query: 88 DVDDYSLYRVFASKYTSIKTAKVILDNS-GYTKGYGFVRFGNEDEQRNALYAMNGYCGLG 264 D+D L + + SK+ ++ V+ D S G ++G+G+V F + ++ +NAL G LG Sbjct: 13 DIDSDGL-KDYMSKFGDLEDCIVMKDRSTGRSRGFGYVTFASAEDAKNAL---KGEHFLG 68 Query: 265 TKPLKICTAVPK 300 + L++ A PK Sbjct: 69 NRILEVKVATPK 80 >At2g21690.1 68415.m02580 RNA-binding protein, putative similar to Glycine-rich RNA-binding protein from {Sinapis alba} SP|P49311, {Brassica napus} SP|Q05966, {Arabidopsis thaliana} SP|Q03251; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 117 Score = 37.5 bits (83), Expect = 0.003 Identities = 20/65 (30%), Positives = 38/65 (58%), Gaps = 1/65 (1%) Frame = +1 Query: 55 EFSVWVGDLSPDVDDYSLYRVFASKYTSIKTAKVILD-NSGYTKGYGFVRFGNEDEQRNA 231 E++ +V L D D+ L +F SK+ ++ +K+I D ++G ++ +GFV F E +A Sbjct: 6 EYTCFVRGLDQDTDEKDLTDIF-SKFGNVIDSKIIYDRDTGKSRRFGFVTFEEEKSMTDA 64 Query: 232 LYAMN 246 + M+ Sbjct: 65 IMIMD 69 >At1g60650.2 68414.m06828 glycine-rich RNA-binding protein, putative similar to RNA binding protein(RZ-1) GI:1435061 from [Nicotiana sylvestris]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 292 Score = 37.5 bits (83), Expect = 0.003 Identities = 25/83 (30%), Positives = 44/83 (53%), Gaps = 1/83 (1%) Frame = +1 Query: 55 EFSVWVGDLSPDVDDYSLYRVFASKYTSIKTAKVILD-NSGYTKGYGFVRFGNEDEQRNA 231 E ++VG LS DV + L F +Y I ++++ ++G +G+GF+ F + +A Sbjct: 11 ESRIFVGGLSWDVTERQLESTF-DRYGKITECQIMVGRDTGRPRGFGFITFTDRRGADDA 69 Query: 232 LYAMNGYCGLGTKPLKICTAVPK 300 + M+G LG K + + A PK Sbjct: 70 IKHMHGR-ELGNKVISVNKAEPK 91 >At1g60650.1 68414.m06827 glycine-rich RNA-binding protein, putative similar to RNA binding protein(RZ-1) GI:1435061 from [Nicotiana sylvestris]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 292 Score = 37.5 bits (83), Expect = 0.003 Identities = 25/83 (30%), Positives = 44/83 (53%), Gaps = 1/83 (1%) Frame = +1 Query: 55 EFSVWVGDLSPDVDDYSLYRVFASKYTSIKTAKVILD-NSGYTKGYGFVRFGNEDEQRNA 231 E ++VG LS DV + L F +Y I ++++ ++G +G+GF+ F + +A Sbjct: 11 ESRIFVGGLSWDVTERQLESTF-DRYGKITECQIMVGRDTGRPRGFGFITFTDRRGADDA 69 Query: 232 LYAMNGYCGLGTKPLKICTAVPK 300 + M+G LG K + + A PK Sbjct: 70 IKHMHGR-ELGNKVISVNKAEPK 91 >At5g19030.2 68418.m02262 RNA recognition motif (RRM)-containing protein low similarity to Cold-inducible RNA-binding protein (Glycine-rich RNA-binding protein CIRP) from {Homo sapiens} SP|Q14011, {Rattus norvegicus} SP|Q61413,{Xenopus laevis} SP|O93235; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 126 Score = 37.1 bits (82), Expect = 0.005 Identities = 20/64 (31%), Positives = 39/64 (60%), Gaps = 1/64 (1%) Frame = +1 Query: 61 SVWVGDLSPDVDDYSLYRVFASKYTSIKTAKVIL-DNSGYTKGYGFVRFGNEDEQRNALY 237 S++V S V + L +VF S++ + K+I + + + GYG+V F ++++ ++A+ Sbjct: 59 SLFVKGFSDSVSEGRLKKVF-SEFGQVTNVKIIANERTRQSLGYGYVWFNSKEDAQSAVE 117 Query: 238 AMNG 249 AMNG Sbjct: 118 AMNG 121 >At5g19030.1 68418.m02261 RNA recognition motif (RRM)-containing protein low similarity to Cold-inducible RNA-binding protein (Glycine-rich RNA-binding protein CIRP) from {Homo sapiens} SP|Q14011, {Rattus norvegicus} SP|Q61413,{Xenopus laevis} SP|O93235; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 172 Score = 37.1 bits (82), Expect = 0.005 Identities = 20/64 (31%), Positives = 39/64 (60%), Gaps = 1/64 (1%) Frame = +1 Query: 61 SVWVGDLSPDVDDYSLYRVFASKYTSIKTAKVIL-DNSGYTKGYGFVRFGNEDEQRNALY 237 S++V S V + L +VF S++ + K+I + + + GYG+V F ++++ ++A+ Sbjct: 78 SLFVKGFSDSVSEGRLKKVF-SEFGQVTNVKIIANERTRQSLGYGYVWFNSKEDAQSAVE 136 Query: 238 AMNG 249 AMNG Sbjct: 137 AMNG 140 >At4g13860.1 68417.m02147 glycine-rich RNA-binding protein, putative similar to Glycine-rich RNA-binding protein 2, mitochondrial precursor (AtGRP2) (Swiss-Prot:Q9SVM8) [Arabidopsis thaliana] ; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 87 Score = 37.1 bits (82), Expect = 0.005 Identities = 22/63 (34%), Positives = 35/63 (55%), Gaps = 1/63 (1%) Frame = +1 Query: 64 VWVGDLSPDVDDYSLYRVFASKYTSIKTAKVILDN-SGYTKGYGFVRFGNEDEQRNALYA 240 V+VG+LSP D L F S Y ++ A V+ D + ++G+GFV + + E A+ Sbjct: 5 VYVGNLSPTTTDDMLREAF-SGYGNVVDAIVMRDRYTDRSRGFGFVTYSSHSEAEAAVSG 63 Query: 241 MNG 249 M+G Sbjct: 64 MDG 66 >At2g35410.1 68415.m04340 33 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein cp33, putative similar to SP|P19684 33 kDa ribonucleoprotein, chloroplast precursor {Nicotiana sylvestris}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 308 Score = 37.1 bits (82), Expect = 0.005 Identities = 19/63 (30%), Positives = 31/63 (49%), Gaps = 1/63 (1%) Frame = +1 Query: 64 VWVGDLSPDVDDYSLYRVF-ASKYTSIKTAKVILDNSGYTKGYGFVRFGNEDEQRNALYA 240 ++V +L+ L +F A+ + + V D G + GYGFV F +E NA+ Sbjct: 196 LYVSNLAWKARSTHLRELFTAADFNPVSARVVFADPEGRSSGYGFVSFATREEAENAITK 255 Query: 241 MNG 249 +NG Sbjct: 256 LNG 258 >At5g09880.1 68418.m01142 RNA recognition motif (RRM)-containing protein Length = 527 Score = 36.3 bits (80), Expect = 0.008 Identities = 18/74 (24%), Positives = 43/74 (58%), Gaps = 1/74 (1%) Frame = +1 Query: 64 VWVGDLSPDVDDYSLYRVFASKYTSIKTAKVILD-NSGYTKGYGFVRFGNEDEQRNALYA 240 ++VG+L ++ + L ++F + + ++ ++ LD +G KG+GF++F + + A A Sbjct: 267 LYVGNLHFNMSELQLRQIFEA-FGPVELVQLPLDPETGQCKGFGFIQFVQLEHSKAAQIA 325 Query: 241 MNGYCGLGTKPLKI 282 +NG + + +K+ Sbjct: 326 LNGKLEIAGRTIKV 339 >At4g03110.1 68417.m00420 RNA-binding protein, putative similar to Etr-1 [Danio rerio] GI:7670536, BRUNO-like 6 RNA-binding protein [Homo sapiens] GI:15341327, CUG-BP and ETR-3 like factor 3 [Homo sapiens] GI:12746392; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 441 Score = 36.3 bits (80), Expect = 0.008 Identities = 23/75 (30%), Positives = 43/75 (57%), Gaps = 1/75 (1%) Frame = +1 Query: 61 SVWVGDLSPDVDDYSLYRVFASKYTSIKTAKVILDNS-GYTKGYGFVRFGNEDEQRNALY 237 ++++ ++ + D L F S + + +AKV +D + G +K +GFV + ++ +NA+ Sbjct: 350 NLFIYNIPREFGDQELAAAFQS-FGIVLSAKVFVDKATGVSKCFGFVSYDSQAAAQNAID 408 Query: 238 AMNGYCGLGTKPLKI 282 MNG LG K LK+ Sbjct: 409 MMNGR-HLGGKKLKV 422 Score = 33.9 bits (74), Expect = 0.042 Identities = 17/65 (26%), Positives = 38/65 (58%) Frame = +1 Query: 55 EFSVWVGDLSPDVDDYSLYRVFASKYTSIKTAKVILDNSGYTKGYGFVRFGNEDEQRNAL 234 E ++VG L +V + + +F SKY +IK +++ +KG F+++ +++ +A+ Sbjct: 105 EHKLFVGMLPKNVSEAEVQSLF-SKYGTIKDLQILRGAQQTSKGCAFLKYETKEQAVSAM 163 Query: 235 YAMNG 249 ++NG Sbjct: 164 ESING 168 >At3g52380.1 68416.m05757 33 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein cp33, putative similar to chloroplast RNA-binding protein (cp33) GB:BAA06523 (Arabidopsis thaliana) (Plant Mol. Biol. 27 (3), 529-539 (1995)); contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 329 Score = 36.3 bits (80), Expect = 0.008 Identities = 20/63 (31%), Positives = 36/63 (57%), Gaps = 1/63 (1%) Frame = +1 Query: 64 VWVGDLSPDVDDYSLYRVFASKYTSIKTAKVILD-NSGYTKGYGFVRFGNEDEQRNALYA 240 V+ G+L ++ L F + + AKVI + N+G ++G+GF+ F + + ++AL Sbjct: 221 VYAGNLGWNLTSQGLKDAFGDQ-PGVLGAKVIYERNTGRSRGFGFISFESAENVQSALAT 279 Query: 241 MNG 249 MNG Sbjct: 280 MNG 282 Score = 31.5 bits (68), Expect = 0.22 Identities = 19/86 (22%), Positives = 39/86 (45%) Frame = +1 Query: 25 ETRANMQHEREFSVWVGDLSPDVDDYSLYRVFASKYTSIKTAKVILDNSGYTKGYGFVRF 204 E + E ++VG+L + L ++F T + V + ++G+GFV Sbjct: 105 EKQTTQASGEEGRLYVGNLPYTITSSELSQIFGEAGTVVDVQIVYDKVTDRSRGFGFVTM 164 Query: 205 GNEDEQRNALYAMNGYCGLGTKPLKI 282 G+ +E + A+ N +G + +K+ Sbjct: 165 GSIEEAKEAMQMFNS-SQIGGRTVKV 189 >At2g41060.1 68415.m05070 RNA recognition motif (RRM)-containing protein similar to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 451 Score = 36.3 bits (80), Expect = 0.008 Identities = 22/58 (37%), Positives = 31/58 (53%), Gaps = 1/58 (1%) Frame = +1 Query: 64 VWVGDLSPDVDDYSLYRVFASKYTSIKTAKVILDN-SGYTKGYGFVRFGNEDEQRNAL 234 ++V L D SL F +Y I+ K ++D SG +KGYGF+ F + RNAL Sbjct: 130 IFVHGLGWDTKADSLIDAF-KQYGEIEDCKCVVDKVSGQSKGYGFILFKSRSGARNAL 186 >At1g76460.1 68414.m08893 RNA recognition motif (RRM)-containing protein low similarity to RRM-containing protein SEB-4 [Xenopus laevis] GI:8895698; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 285 Score = 36.3 bits (80), Expect = 0.008 Identities = 23/57 (40%), Positives = 33/57 (57%), Gaps = 1/57 (1%) Frame = +1 Query: 64 VWVGDLSPDVDDYSLYRVFASKYTSIKTAKVILD-NSGYTKGYGFVRFGNEDEQRNA 231 V+VG L+ + +L + F +Y I A VI D N+G +KGYGFV F + + R A Sbjct: 26 VFVGGLAWETQSETLRQHF-EQYGEILEAVVIADKNTGRSKGYGFVTFRDPEAARRA 81 >At1g58470.1 68414.m06651 RNA-binding protein (XF41) identical to RNA binding protein GI:18181938 from (Arabidopsis thaliana); contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) domain 15450911 gb AY054536.1 Length = 360 Score = 36.3 bits (80), Expect = 0.008 Identities = 25/88 (28%), Positives = 49/88 (55%), Gaps = 1/88 (1%) Frame = +1 Query: 40 MQHEREFSVWVGDLSPDVDDYSLYRVFASKYTSIKTAKVILDN-SGYTKGYGFVRFGNED 216 M ++R + ++VG ++ + + +L + F S+Y ++ A V + +G +G+GFVRF N+ Sbjct: 1 MDYDR-YKLFVGGIAKETSEEALKQYF-SRYGAVLEAVVAKEKVTGKPRGFGFVRFANDC 58 Query: 217 EQRNALYAMNGYCGLGTKPLKICTAVPK 300 + AL + G KP+ + A+ K Sbjct: 59 DVVKALRDTHFILG---KPVDVRKAIRK 83 >At5g06000.1 68418.m00665 eukaryotic translation initiation factor 3G, putative / eIF3g, putative similar to eukaryotic translation initiation factor 3g [Arabidopsis thaliana] GI:12407751; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 276 Score = 35.9 bits (79), Expect = 0.010 Identities = 24/83 (28%), Positives = 43/83 (51%), Gaps = 1/83 (1%) Frame = +1 Query: 55 EFSVWVGDLSPDVDDYSLYRVFASKYTSIKTAKVILDN-SGYTKGYGFVRFGNEDEQRNA 231 E SV V +LS D L +F + ++ V +D + ++G+GFV F + ++ + A Sbjct: 173 ENSVRVTNLSEDTRGPDLMELFRP-FGAVTRCHVAIDQKTSMSRGFGFVSFVSREDAQRA 231 Query: 232 LYAMNGYCGLGTKPLKICTAVPK 300 + +NGY G L++ + PK Sbjct: 232 INKLNGY-GYDNLILRVEWSTPK 253 >At1g51510.1 68414.m05797 RNA-binding protein, putative similar to RNA-binding protein 8 (Ribonucleoprotein RBM8) SP:Q9Y5S9 from [Homo sapiens], RNA-binding protein Y14 [Xenopus laevis] GI:11034807; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 202 Score = 35.9 bits (79), Expect = 0.010 Identities = 16/41 (39%), Positives = 25/41 (60%), Gaps = 1/41 (2%) Frame = +1 Query: 130 YTSIKTAKVILDN-SGYTKGYGFVRFGNEDEQRNALYAMNG 249 + IK + LD SGY KGY + + ++E ++A+ AMNG Sbjct: 118 FGEIKNLNLNLDRRSGYVKGYALIEYEKKEEAQSAISAMNG 158 >At3g52150.1 68416.m05724 RNA recognition motif (RRM)-containing protein similar to chloroplast RNA-binding protein cp33 [Arabidopsis thaliana] GI:681912; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) domain Length = 253 Score = 35.5 bits (78), Expect = 0.014 Identities = 17/63 (26%), Positives = 33/63 (52%) Frame = +1 Query: 58 FSVWVGDLSPDVDDYSLYRVFASKYTSIKTAKVILDNSGYTKGYGFVRFGNEDEQRNALY 237 + V+VG+L+ V L +F+ K + + + + G+GFV F +E++ A+ Sbjct: 177 YKVYVGNLAKTVTKEMLENLFSEKGKVVSAKVSRVPGTSKSTGFGFVTFSSEEDVEAAIV 236 Query: 238 AMN 246 A+N Sbjct: 237 ALN 239 >At5g40490.1 68418.m04910 RNA recognition motif (RRM)-containing protein ribonucleoprotein, Xenopus laevis, PIR:S40778; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 423 Score = 35.1 bits (77), Expect = 0.018 Identities = 23/85 (27%), Positives = 46/85 (54%), Gaps = 1/85 (1%) Frame = +1 Query: 64 VWVGDLSPDVDDYSLYRVFASKYTSIKTAKVILDNS-GYTKGYGFVRFGNEDEQRNALYA 240 ++VG + VDD ++ F ++ +K +++ D+S G ++G+GFV + +ED + L A Sbjct: 132 IFVGGIPSSVDDDE-FKEFFMQFGELKEHQIMRDHSTGRSRGFGFVTYESED-MVDHLLA 189 Query: 241 MNGYCGLGTKPLKICTAVPKPKSNL 315 L ++I A PK +++ Sbjct: 190 KGNRIELSGTQVEIKKAEPKKPNSV 214 >At3g56860.3 68416.m06325 UBP1 interacting protein 2a (UBA2a) identical to UBP1 interacting protein 2a [Arabidopsis thaliana] GI:19682816; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 478 Score = 35.1 bits (77), Expect = 0.018 Identities = 20/58 (34%), Positives = 30/58 (51%), Gaps = 1/58 (1%) Frame = +1 Query: 64 VWVGDLSPDVDDYSLYRVFASKYTSIKTAKVILDN-SGYTKGYGFVRFGNEDEQRNAL 234 ++V L D +L F +Y I+ K + D SG +KGYGF+ + + RNAL Sbjct: 142 IFVHGLGWDTKTETLIEAF-KQYGEIEDCKAVFDKISGKSKGYGFILYKSRSGARNAL 198 >At3g56860.2 68416.m06324 UBP1 interacting protein 2a (UBA2a) identical to UBP1 interacting protein 2a [Arabidopsis thaliana] GI:19682816; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 478 Score = 35.1 bits (77), Expect = 0.018 Identities = 20/58 (34%), Positives = 30/58 (51%), Gaps = 1/58 (1%) Frame = +1 Query: 64 VWVGDLSPDVDDYSLYRVFASKYTSIKTAKVILDN-SGYTKGYGFVRFGNEDEQRNAL 234 ++V L D +L F +Y I+ K + D SG +KGYGF+ + + RNAL Sbjct: 142 IFVHGLGWDTKTETLIEAF-KQYGEIEDCKAVFDKISGKSKGYGFILYKSRSGARNAL 198 >At3g56860.1 68416.m06323 UBP1 interacting protein 2a (UBA2a) identical to UBP1 interacting protein 2a [Arabidopsis thaliana] GI:19682816; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 478 Score = 35.1 bits (77), Expect = 0.018 Identities = 20/58 (34%), Positives = 30/58 (51%), Gaps = 1/58 (1%) Frame = +1 Query: 64 VWVGDLSPDVDDYSLYRVFASKYTSIKTAKVILDN-SGYTKGYGFVRFGNEDEQRNAL 234 ++V L D +L F +Y I+ K + D SG +KGYGF+ + + RNAL Sbjct: 142 IFVHGLGWDTKTETLIEAF-KQYGEIEDCKAVFDKISGKSKGYGFILYKSRSGARNAL 198 >At4g16280.3 68417.m02471 flowering time control protein / FCA gamma (FCA) identical to SP|O04425 Flowering time control protein FCA {Arabidopsis thaliana}; four alternative splice variants, one splicing isoform contains a non-consensus CA donor splice site, based on cDNA: gi:2204090 Length = 533 Score = 34.7 bits (76), Expect = 0.024 Identities = 23/87 (26%), Positives = 46/87 (52%), Gaps = 3/87 (3%) Frame = +1 Query: 55 EFSVWVGDLSPDVDDYSLYRVFASKYTSIKTAKVILDNSGYTKGYGFVRFGNEDEQRNAL 234 EF ++VG L+ + + +F ++ ++ ++ D ++G GFV++ +++ A+ Sbjct: 210 EFKLFVGSLNKQATEKEVEEIFL-QFGHVEDVYLMRDEYRQSRGCGFVKYSSKETAMAAI 268 Query: 235 YAMNG-YCGLG-TKPLKICTAVPK-PK 306 +NG Y G +PL + A PK PK Sbjct: 269 DGLNGTYTMRGCNQPLIVRFAEPKRPK 295 >At4g16280.2 68417.m02470 flowering time control protein / FCA gamma (FCA) identical to SP|O04425 Flowering time control protein FCA {Arabidopsis thaliana}; four alternative splice variants, one splicing isoform contains a non-consensus CA donor splice site, based on cDNA: gi:2204090 Length = 747 Score = 34.7 bits (76), Expect = 0.024 Identities = 23/87 (26%), Positives = 46/87 (52%), Gaps = 3/87 (3%) Frame = +1 Query: 55 EFSVWVGDLSPDVDDYSLYRVFASKYTSIKTAKVILDNSGYTKGYGFVRFGNEDEQRNAL 234 EF ++VG L+ + + +F ++ ++ ++ D ++G GFV++ +++ A+ Sbjct: 210 EFKLFVGSLNKQATEKEVEEIFL-QFGHVEDVYLMRDEYRQSRGCGFVKYSSKETAMAAI 268 Query: 235 YAMNG-YCGLG-TKPLKICTAVPK-PK 306 +NG Y G +PL + A PK PK Sbjct: 269 DGLNGTYTMRGCNQPLIVRFAEPKRPK 295 >At2g46780.1 68415.m05836 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 304 Score = 34.7 bits (76), Expect = 0.024 Identities = 22/62 (35%), Positives = 33/62 (53%), Gaps = 1/62 (1%) Frame = +1 Query: 64 VWVGDLSPDVDDYSLYRVFASKYTSIKTAKVILD-NSGYTKGYGFVRFGNEDEQRNALYA 240 ++VG L+ + ++ R F ++ I A VI D N+G +KGYGFV F + A Sbjct: 24 IFVGGLAWETQRDTMRRYF-EQFGEIVEAVVITDKNTGRSKGYGFVTFKEAEAAMRACQN 82 Query: 241 MN 246 MN Sbjct: 83 MN 84 >At2g21440.1 68415.m02551 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 1003 Score = 34.7 bits (76), Expect = 0.024 Identities = 16/44 (36%), Positives = 26/44 (59%) Frame = +1 Query: 169 SGYTKGYGFVRFGNEDEQRNALYAMNGYCGLGTKPLKICTAVPK 300 +G KG+ FV+F + + NA+ NG+ G +P+ + AVPK Sbjct: 368 TGLPKGFAFVKFTCKKDAANAIKKFNGHM-FGKRPIAVDWAVPK 410 >At5g41690.1 68418.m05067 polyadenylate-binding protein, putative / PABP, putative similar to poly(A)-binding protein GI:7673355 from [Nicotiana tabacum]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 620 Score = 34.3 bits (75), Expect = 0.032 Identities = 19/66 (28%), Positives = 35/66 (53%) Frame = +1 Query: 52 REFSVWVGDLSPDVDDYSLYRVFASKYTSIKTAKVILDNSGYTKGYGFVRFGNEDEQRNA 231 R+ +++V +LSP + + F + ++I+++ G G GFV F + +E + A Sbjct: 487 RKKTLFVANLSPRTKISHIIKFFKD-VAEVVRVRLIVNHRGEHVGCGFVEFASVNEAQKA 545 Query: 232 LYAMNG 249 L MNG Sbjct: 546 LQKMNG 551 Score = 30.7 bits (66), Expect = 0.39 Identities = 15/46 (32%), Positives = 22/46 (47%) Frame = +1 Query: 118 FASKYTSIKTAKVILDNSGYTKGYGFVRFGNEDEQRNALYAMNGYC 255 F K + ++I++ G G GFV F + +E AL NG C Sbjct: 146 FFKKVGEVVRVQLIVNLKGKLVGCGFVEFASVNEAEEALQKKNGEC 191 >At4g14300.1 68417.m02203 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative Length = 411 Score = 34.3 bits (75), Expect = 0.032 Identities = 26/99 (26%), Positives = 50/99 (50%), Gaps = 1/99 (1%) Frame = +1 Query: 7 LNTASRETRANMQHEREFSVWVGDLSPDVDDYSLYRVFASKYTSIKTAKVILDNS-GYTK 183 LNT SR + + ++ + ++VG L P + D +R + Y + ++ D + + Sbjct: 95 LNT-SRSSGGDAYNKTK-KIFVGGLPPTLTDEE-FRQYFEVYGPVTDVAIMYDQATNRPR 151 Query: 184 GYGFVRFGNEDEQRNALYAMNGYCGLGTKPLKICTAVPK 300 G+GFV F +ED + L+ + L K +++ A+PK Sbjct: 152 GFGFVSFDSEDAVDSVLH--KTFHDLSGKQVEVKRALPK 188 >At1g78260.2 68414.m09119 RNA recognition motif (RRM)-containing protein similar to RNA recognition motif-containing protein SEB-4 GI:8895698 from [Xenopus laevis]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 271 Score = 34.3 bits (75), Expect = 0.032 Identities = 21/58 (36%), Positives = 31/58 (53%), Gaps = 1/58 (1%) Frame = +1 Query: 64 VWVGDLSPDVDDYSLYRVFASKYTSIKTAKVILD-NSGYTKGYGFVRFGNEDEQRNAL 234 V+VG L+ + + R F ++ I A +I D N+G +KGYGFV F D A+ Sbjct: 19 VFVGGLAWETPTDEMRRYF-EQFGEILEAVIITDKNTGKSKGYGFVTFRESDSATRAV 75 >At1g78260.1 68414.m09120 RNA recognition motif (RRM)-containing protein similar to RNA recognition motif-containing protein SEB-4 GI:8895698 from [Xenopus laevis]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 287 Score = 34.3 bits (75), Expect = 0.032 Identities = 21/58 (36%), Positives = 31/58 (53%), Gaps = 1/58 (1%) Frame = +1 Query: 64 VWVGDLSPDVDDYSLYRVFASKYTSIKTAKVILD-NSGYTKGYGFVRFGNEDEQRNAL 234 V+VG L+ + + R F ++ I A +I D N+G +KGYGFV F D A+ Sbjct: 19 VFVGGLAWETPTDEMRRYF-EQFGEILEAVIITDKNTGKSKGYGFVTFRESDSATRAV 75 >At4g03110.2 68417.m00421 RNA-binding protein, putative similar to Etr-1 [Danio rerio] GI:7670536, BRUNO-like 6 RNA-binding protein [Homo sapiens] GI:15341327, CUG-BP and ETR-3 like factor 3 [Homo sapiens] GI:12746392; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 439 Score = 33.9 bits (74), Expect = 0.042 Identities = 17/65 (26%), Positives = 38/65 (58%) Frame = +1 Query: 55 EFSVWVGDLSPDVDDYSLYRVFASKYTSIKTAKVILDNSGYTKGYGFVRFGNEDEQRNAL 234 E ++VG L +V + + +F SKY +IK +++ +KG F+++ +++ +A+ Sbjct: 105 EHKLFVGMLPKNVSEAEVQSLF-SKYGTIKDLQILRGAQQTSKGCAFLKYETKEQAVSAM 163 Query: 235 YAMNG 249 ++NG Sbjct: 164 ESING 168 >At5g59860.1 68418.m07506 RNA recognition motif (RRM)-containing protein similar to SP|Q14011 Cold-inducible RNA-binding protein (Glycine-rich RNA-binding protein CIRP) {Homo sapiens}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 157 Score = 33.1 bits (72), Expect = 0.074 Identities = 21/57 (36%), Positives = 31/57 (54%) Frame = +1 Query: 79 LSPDVDDYSLYRVFASKYTSIKTAKVILDNSGYTKGYGFVRFGNEDEQRNALYAMNG 249 LS D SL ++FA IK + + KG+GF+ F +ED+ + AL A+NG Sbjct: 78 LSAYTTDQSLRQLFAPFARLIKDQQ-----TQRPKGFGFITFESEDDAQKALKALNG 129 >At3g15010.2 68416.m01899 RNA recognition motif (RRM)-containing protein similar to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 404 Score = 33.1 bits (72), Expect = 0.074 Identities = 20/52 (38%), Positives = 31/52 (59%), Gaps = 1/52 (1%) Frame = +1 Query: 64 VWVGDLSPDVDDYSLYRVFASKYTSIKTAKVILDN-SGYTKGYGFVRFGNED 216 +++ L+ D L +F+S Y ++ A VILD +G +KGYGFV F + D Sbjct: 77 LFIRGLAADTTTEGLRSLFSS-YGDLEEAIVILDKVTGKSKGYGFVTFMHVD 127 >At3g15010.1 68416.m01898 RNA recognition motif (RRM)-containing protein similar to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 404 Score = 33.1 bits (72), Expect = 0.074 Identities = 20/52 (38%), Positives = 31/52 (59%), Gaps = 1/52 (1%) Frame = +1 Query: 64 VWVGDLSPDVDDYSLYRVFASKYTSIKTAKVILDN-SGYTKGYGFVRFGNED 216 +++ L+ D L +F+S Y ++ A VILD +G +KGYGFV F + D Sbjct: 77 LFIRGLAADTTTEGLRSLFSS-YGDLEEAIVILDKVTGKSKGYGFVTFMHVD 127 >At2g33410.1 68415.m04095 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative Length = 404 Score = 33.1 bits (72), Expect = 0.074 Identities = 22/84 (26%), Positives = 41/84 (48%), Gaps = 1/84 (1%) Frame = +1 Query: 52 REFSVWVGDLSPDVDDYSLYRVFASKYTSIKTAKVILDNSGYT-KGYGFVRFGNEDEQRN 228 R ++VG L P + +R + Y + A +++D + +G+GFV F +ED Sbjct: 108 RTKKIFVGGLPPALTSDE-FRAYFETYGPVSDAVIMIDQTTQRPRGFGFVSFDSEDSVDL 166 Query: 229 ALYAMNGYCGLGTKPLKICTAVPK 300 L+ + L K +++ A+PK Sbjct: 167 VLH--KTFHDLNGKQVEVKRALPK 188 >At1g33470.2 68414.m04143 RNA recognition motif (RRM)-containing protein similar to RRM-containing protein SEB-4 [Xenopus laevis] GI:8895698; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 244 Score = 33.1 bits (72), Expect = 0.074 Identities = 22/57 (38%), Positives = 32/57 (56%), Gaps = 1/57 (1%) Frame = +1 Query: 64 VWVGDLSPDVDDYSLYRVFASKYTSIKTAKVILD-NSGYTKGYGFVRFGNEDEQRNA 231 V+VG L+ + SL F ++ I A VI D +SG +KGYGFV F + + + A Sbjct: 9 VFVGGLAWETHKVSLRNYF-EQFGDIVEAVVITDKSSGRSKGYGFVTFCDPEAAQKA 64 >At1g33470.1 68414.m04142 RNA recognition motif (RRM)-containing protein similar to RRM-containing protein SEB-4 [Xenopus laevis] GI:8895698; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 245 Score = 33.1 bits (72), Expect = 0.074 Identities = 22/57 (38%), Positives = 32/57 (56%), Gaps = 1/57 (1%) Frame = +1 Query: 64 VWVGDLSPDVDDYSLYRVFASKYTSIKTAKVILD-NSGYTKGYGFVRFGNEDEQRNA 231 V+VG L+ + SL F ++ I A VI D +SG +KGYGFV F + + + A Sbjct: 9 VFVGGLAWETHKVSLRNYF-EQFGDIVEAVVITDKSSGRSKGYGFVTFCDPEAAQKA 64 >At1g53720.1 68414.m06113 cyclophilin-RNA interacting protein, putative Length = 506 Score = 32.7 bits (71), Expect = 0.097 Identities = 18/62 (29%), Positives = 36/62 (58%), Gaps = 1/62 (1%) Frame = +1 Query: 64 VWVGDLSPDVDDYSLYRVFASKYTSIKTAKVILD-NSGYTKGYGFVRFGNEDEQRNALYA 240 ++V L+P +D L+ +F S++ ++ +A VI D +G + Y F+ F N++ A + Sbjct: 245 LFVCKLNPVTEDEDLHTIF-SRFGTVVSADVIRDFKTGDSLCYAFIEFENKESCEQAYFK 303 Query: 241 MN 246 M+ Sbjct: 304 MD 305 >At3g47120.1 68416.m05116 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 352 Score = 32.3 bits (70), Expect = 0.13 Identities = 27/96 (28%), Positives = 47/96 (48%), Gaps = 2/96 (2%) Frame = +1 Query: 19 SRETRANMQHEREFSVWVGDLSPDVDDYSLYRVFASKYTSIKTAKVILDN-SGYTKGYGF 195 S E + +++ V+VG + D+ + L VF S+Y I +I D +G +KG+ F Sbjct: 23 SDEASWHAKYKNSAYVYVGGIPFDLTEGDLLAVF-SQYGEIVDVNLIRDKGTGKSKGFAF 81 Query: 196 VRFGNEDEQRNALYAMNGYCGLG-TKPLKICTAVPK 300 + + ++ A+ +NG LG T + C A K Sbjct: 82 LAYEDQRSTILAVDNLNGALVLGRTIKVDHCGAYKK 117 >At1g22910.3 68414.m02863 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); similar to GB:AAC33496 Length = 347 Score = 32.3 bits (70), Expect = 0.13 Identities = 21/57 (36%), Positives = 32/57 (56%), Gaps = 1/57 (1%) Frame = +1 Query: 64 VWVGDLSPDVDDYSLYRVFASKYTSIKTAKVILDN-SGYTKGYGFVRFGNEDEQRNA 231 V+VG L+ + ++ + F ++ I A VI D SG +KGYGFV F + R+A Sbjct: 15 VFVGGLAWETHKETMKKHF-EQFGEILEAVVITDKASGRSKGYGFVTFREAEAARSA 70 >At1g22910.2 68414.m02861 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); similar to GB:AAC33496 Length = 242 Score = 32.3 bits (70), Expect = 0.13 Identities = 21/57 (36%), Positives = 32/57 (56%), Gaps = 1/57 (1%) Frame = +1 Query: 64 VWVGDLSPDVDDYSLYRVFASKYTSIKTAKVILDN-SGYTKGYGFVRFGNEDEQRNA 231 V+VG L+ + ++ + F ++ I A VI D SG +KGYGFV F + R+A Sbjct: 15 VFVGGLAWETHKETMKKHF-EQFGEILEAVVITDKASGRSKGYGFVTFREAEAARSA 70 >At1g22910.1 68414.m02862 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); similar to GB:AAC33496 Length = 249 Score = 32.3 bits (70), Expect = 0.13 Identities = 21/57 (36%), Positives = 32/57 (56%), Gaps = 1/57 (1%) Frame = +1 Query: 64 VWVGDLSPDVDDYSLYRVFASKYTSIKTAKVILDN-SGYTKGYGFVRFGNEDEQRNA 231 V+VG L+ + ++ + F ++ I A VI D SG +KGYGFV F + R+A Sbjct: 15 VFVGGLAWETHKETMKKHF-EQFGEILEAVVITDKASGRSKGYGFVTFREAEAARSA 70 >At1g22330.1 68414.m02793 RNA recognition motif (RRM)-containing protein similar to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 146 Score = 32.3 bits (70), Expect = 0.13 Identities = 20/58 (34%), Positives = 31/58 (53%), Gaps = 1/58 (1%) Frame = +1 Query: 64 VWVGDLSPDVDDYSLYRVFASKYTSIKTAKVILDNS-GYTKGYGFVRFGNEDEQRNAL 234 V+VG L+ + + R F ++ I A +I D + G +KGYGFV F + D A+ Sbjct: 19 VFVGGLAWETPTDEMRRYF-DQFGEILEAVIITDKATGKSKGYGFVTFRDSDSATRAV 75 >At2g43370.1 68415.m05392 U1 small nuclear ribonucleoprotein 70 kDa, putative Length = 333 Score = 31.9 bits (69), Expect = 0.17 Identities = 20/58 (34%), Positives = 32/58 (55%), Gaps = 1/58 (1%) Frame = +1 Query: 61 SVWVGDLSPDVDDYSLYRVFASKYTSIKTAKVILDN-SGYTKGYGFVRFGNEDEQRNA 231 +++VG LS + +L V SKY IK +++ +G ++GYGFV + E E A Sbjct: 65 TLFVGRLSHHTTEDTLREVM-SKYGRIKNLRLVRHIVTGASRGYGFVEYETEKEMLRA 121 >At2g37510.1 68415.m04600 RNA-binding protein, putative similar to SP|P10979 Glycine-rich RNA-binding, abscisic acid-inducible protein {Zea mays}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 142 Score = 31.9 bits (69), Expect = 0.17 Identities = 21/62 (33%), Positives = 33/62 (53%), Gaps = 1/62 (1%) Frame = +1 Query: 64 VWVGDLSPDVDDYSLYRVFASKYTSIKTAKVILD-NSGYTKGYGFVRFGNEDEQRNALYA 240 ++V LS + L FAS + + A+VI D +SG +KG+GFV + ++ A Sbjct: 36 LFVSGLSRLTTNEKLQDAFAS-FGQLVDARVITDRDSGRSKGFGFVTYATIEDAEKAKAE 94 Query: 241 MN 246 MN Sbjct: 95 MN 96 >At2g19380.1 68415.m02260 RNA recognition motif (RRM)-containing protein similar to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); contains Pfam profile PF00096: Zinc finger, C2H2 type Length = 613 Score = 31.5 bits (68), Expect = 0.22 Identities = 20/59 (33%), Positives = 29/59 (49%), Gaps = 1/59 (1%) Frame = +1 Query: 61 SVWVGDLSPDVDDYSLYRVFASKYTSIKTAKVILD-NSGYTKGYGFVRFGNEDEQRNAL 234 +++V D +L F S Y I+ V++D ++G KGYGFV F R AL Sbjct: 409 NIFVRGFGWDTTQENLKTAFES-YGEIEECSVVMDKDTGRGKGYGFVMFKTRKGAREAL 466 >At2g47310.1 68415.m05906 flowering time control protein-related / FCA gamma-related Length = 512 Score = 31.1 bits (67), Expect = 0.30 Identities = 23/81 (28%), Positives = 40/81 (49%), Gaps = 2/81 (2%) Frame = +1 Query: 64 VWVGDLSPDVDDYSLYRVFASKYTSIKTAKVILDNSGYTKGYGFVRFGNEDEQRNALYAM 243 ++V L+ + VF S+Y I+ + LD+ +GY FV+F ++ A+ A+ Sbjct: 209 LYVRCLNKQTTKMEVNEVF-SRYGIIEDIYMALDDMKICRGYAFVQFSCKEMALAAIKAL 267 Query: 244 NGYCGL--GTKPLKICTAVPK 300 NG + +PL + A PK Sbjct: 268 NGLFTIRGSDQPLIVRFADPK 288 >At4g02430.2 68417.m00330 pre-mRNA splicing factor, putative / SR1 protein, putative strong similarity to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana}; cDNA NCBI_gi:15810292 supports a truncated version while protein evidence supports a longer model. Length = 278 Score = 30.7 bits (66), Expect = 0.39 Identities = 18/64 (28%), Positives = 34/64 (53%) Frame = +1 Query: 61 SVWVGDLSPDVDDYSLYRVFASKYTSIKTAKVILDNSGYTKGYGFVRFGNEDEQRNALYA 240 +++VG+L D+ + + +F SKY + ++ L GY FV F + + +A+Y Sbjct: 8 TIYVGNLPGDIREREVEDLF-SKYGPV--VQIDLKIPPRPPGYAFVEFEDARDADDAIYG 64 Query: 241 MNGY 252 +GY Sbjct: 65 RDGY 68 >At4g02430.1 68417.m00329 pre-mRNA splicing factor, putative / SR1 protein, putative strong similarity to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana}; cDNA NCBI_gi:15810292 supports a truncated version while protein evidence supports a longer model. Length = 178 Score = 30.7 bits (66), Expect = 0.39 Identities = 18/64 (28%), Positives = 34/64 (53%) Frame = +1 Query: 61 SVWVGDLSPDVDDYSLYRVFASKYTSIKTAKVILDNSGYTKGYGFVRFGNEDEQRNALYA 240 +++VG+L D+ + + +F SKY + ++ L GY FV F + + +A+Y Sbjct: 8 TIYVGNLPGDIREREVEDLF-SKYGPV--VQIDLKIPPRPPGYAFVEFEDARDADDAIYG 64 Query: 241 MNGY 252 +GY Sbjct: 65 RDGY 68 >At5g25060.1 68418.m02970 RNA recognition motif (RRM)-containing protein KIAA0332 - Homo sapiens, EMBL:AB002330 Length = 946 Score = 30.3 bits (65), Expect = 0.52 Identities = 21/67 (31%), Positives = 34/67 (50%), Gaps = 4/67 (5%) Frame = +1 Query: 61 SVWVGDLSPDVDDYSLYRVFASKYTSIKTAKVILDNSGYTK----GYGFVRFGNEDEQRN 228 +++VG+LSP VD+ L R F ++ I + K++ + K GFV F N + + Sbjct: 180 NLYVGNLSPKVDENFLLRTF-GRFGPIASVKIMWPRTDEEKRRQRNCGFVSFMNRADGQA 238 Query: 229 ALYAMNG 249 A M G Sbjct: 239 AKDEMQG 245 >At4g09040.1 68417.m01491 RNA recognition motif (RRM)-containing protein low similarity to enhancer binding protein-1; EBP1 [Entamoeba histolytica] GI:8163877, SP|P19682 28 kDa ribonucleoprotein, chloroplast precursor (28RNP) {Nicotiana sylvestris}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 304 Score = 30.3 bits (65), Expect = 0.52 Identities = 20/76 (26%), Positives = 39/76 (51%), Gaps = 1/76 (1%) Frame = +1 Query: 58 FSVWVGDLSPDVDDYSLYRVFASKYTSIKTAKVIL-DNSGYTKGYGFVRFGNEDEQRNAL 234 F+++V +L+ + L F + ++ + +VI +N + GYGFV F + + AL Sbjct: 189 FNLFVANLAFEARAKHLKEFFDADTGNVVSTEVIFHENPRRSSGYGFVSFKTKKQAEAAL 248 Query: 235 YAMNGYCGLGTKPLKI 282 G LG +P+++ Sbjct: 249 IEFQGKDFLG-RPIRL 263 >At1g02840.3 68414.m00246 pre-mRNA splicing factor SF2 (SF2) / SR1 protein identical to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana} Length = 303 Score = 30.3 bits (65), Expect = 0.52 Identities = 18/64 (28%), Positives = 34/64 (53%) Frame = +1 Query: 61 SVWVGDLSPDVDDYSLYRVFASKYTSIKTAKVILDNSGYTKGYGFVRFGNEDEQRNALYA 240 +V+VG+L D+ + + +F SKY + ++ L GY FV F + + +A++ Sbjct: 8 TVYVGNLPGDIREREVEDLF-SKYGPV--VQIDLKVPPRPPGYAFVEFDDARDAEDAIHG 64 Query: 241 MNGY 252 +GY Sbjct: 65 RDGY 68 >At1g02840.2 68414.m00244 pre-mRNA splicing factor SF2 (SF2) / SR1 protein identical to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana} Length = 285 Score = 30.3 bits (65), Expect = 0.52 Identities = 18/64 (28%), Positives = 34/64 (53%) Frame = +1 Query: 61 SVWVGDLSPDVDDYSLYRVFASKYTSIKTAKVILDNSGYTKGYGFVRFGNEDEQRNALYA 240 +V+VG+L D+ + + +F SKY + ++ L GY FV F + + +A++ Sbjct: 8 TVYVGNLPGDIREREVEDLF-SKYGPV--VQIDLKVPPRPPGYAFVEFDDARDAEDAIHG 64 Query: 241 MNGY 252 +GY Sbjct: 65 RDGY 68 >At1g02840.1 68414.m00245 pre-mRNA splicing factor SF2 (SF2) / SR1 protein identical to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana} Length = 303 Score = 30.3 bits (65), Expect = 0.52 Identities = 18/64 (28%), Positives = 34/64 (53%) Frame = +1 Query: 61 SVWVGDLSPDVDDYSLYRVFASKYTSIKTAKVILDNSGYTKGYGFVRFGNEDEQRNALYA 240 +V+VG+L D+ + + +F SKY + ++ L GY FV F + + +A++ Sbjct: 8 TVYVGNLPGDIREREVEDLF-SKYGPV--VQIDLKVPPRPPGYAFVEFDDARDAEDAIHG 64 Query: 241 MNGY 252 +GY Sbjct: 65 RDGY 68 >At4g00830.1 68417.m00114 RNA recognition motif (RRM)-containing protein similar to nucleolin protein; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 495 Score = 29.9 bits (64), Expect = 0.69 Identities = 19/58 (32%), Positives = 31/58 (53%), Gaps = 1/58 (1%) Frame = +1 Query: 64 VWVGDLSPDVDDYSLYRVFASKYTSIKTAKVILD-NSGYTKGYGFVRFGNEDEQRNAL 234 V++G L DV + L R + I +++ D +SG +KGY FV F +D + A+ Sbjct: 118 VFIGGLPRDVGEEDL-RDLCEEIGEIFEVRLMKDRDSGDSKGYAFVAFKTKDVAQKAI 174 >At4g26650.1 68417.m03840 RNA recognition motif (RRM)-containing protein contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 455 Score = 29.5 bits (63), Expect = 0.91 Identities = 15/50 (30%), Positives = 28/50 (56%), Gaps = 1/50 (2%) Frame = +1 Query: 64 VWVGDLSPDVDDYSLYRVFASKYTSIKTAKVILDNS-GYTKGYGFVRFGN 210 +++G +S D D+ L F KY + A ++ D + G +G+GF+ F + Sbjct: 17 LFIGGISWDTDEERLQEYFG-KYGDLVEAVIMRDRTTGRARGFGFIVFAD 65 >At5g64200.2 68418.m08063 arginine/serine-rich splicing factor SC35 contains similarity to splicing factor; contains Pfam profile PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 303 Score = 28.7 bits (61), Expect = 1.6 Identities = 16/49 (32%), Positives = 28/49 (57%), Gaps = 1/49 (2%) Frame = +1 Query: 106 LYRVFASKYTSIKTAKVILDN-SGYTKGYGFVRFGNEDEQRNALYAMNG 249 LY +FA KY + + D +G ++G+ FVR+ +DE A+ ++G Sbjct: 32 LYPLFA-KYGKVVDVFIPRDRRTGDSRGFAFVRYKYKDEAHKAVERLDG 79 >At5g64200.1 68418.m08062 arginine/serine-rich splicing factor SC35 contains similarity to splicing factor; contains Pfam profile PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 303 Score = 28.7 bits (61), Expect = 1.6 Identities = 16/49 (32%), Positives = 28/49 (57%), Gaps = 1/49 (2%) Frame = +1 Query: 106 LYRVFASKYTSIKTAKVILDN-SGYTKGYGFVRFGNEDEQRNALYAMNG 249 LY +FA KY + + D +G ++G+ FVR+ +DE A+ ++G Sbjct: 32 LYPLFA-KYGKVVDVFIPRDRRTGDSRGFAFVRYKYKDEAHKAVERLDG 79 >At3g20930.1 68416.m02645 RNA recognition motif (RRM)-containing protein contains Pfam profile: PF00076 RNA recognition motif Length = 374 Score = 28.7 bits (61), Expect = 1.6 Identities = 14/34 (41%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Frame = +1 Query: 151 KVILDN-SGYTKGYGFVRFGNEDEQRNALYAMNG 249 K+I+D S +KGY F+ + E+ AL MNG Sbjct: 312 KIIMDKISKRSKGYAFLEYTTEEAAGTALKEMNG 345 >At3g10845.1 68416.m01306 RNA recognition motif (RRM)-containing protein similar to SP|P42731 Polyadenylate-binding protein 2 (Poly(A) binding protein 2) (PABP 2) {Arabidopsis thaliana}; contains INTERPRO:IPR000504 RNA-binding region RNP-1 (RNA recognition motif) domain Length = 423 Score = 28.7 bits (61), Expect = 1.6 Identities = 18/52 (34%), Positives = 25/52 (48%), Gaps = 1/52 (1%) Frame = +1 Query: 151 KVILDNSGYTKGYGFVRFGNEDEQRNALYAMNG-YCGLGTKPLKICTAVPKP 303 ++I++++G G GFV F + E NAL G Y G LK P P Sbjct: 213 RLIVNHTGKHVGKGFVEFASAKEAENALEKKKGEYLQDGEIFLKAANIAPFP 264 >At5g04600.1 68418.m00460 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 222 Score = 28.3 bits (60), Expect = 2.1 Identities = 14/46 (30%), Positives = 27/46 (58%), Gaps = 1/46 (2%) Frame = +1 Query: 118 FASKYTSIKTAKVILDN-SGYTKGYGFVRFGNEDEQRNALYAMNGY 252 F S++ ++K +V + +G +K +GF++F + + A AMN Y Sbjct: 79 FFSQFGTVKRVRVARNKKTGKSKHFGFIQFEDPEVAEIAAGAMNDY 124 >At3g13570.1 68416.m01707 SC35-like splicing factor, 30a kD (SCL30a) almost identical to SC35-like splicing factor SCL30a GI:9843661 from [Arabidopsis thaliana]; contains Pfam profile PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 262 Score = 28.3 bits (60), Expect = 2.1 Identities = 20/69 (28%), Positives = 35/69 (50%), Gaps = 1/69 (1%) Frame = +1 Query: 61 SVWVGDLSPDVDDYSLYRVFASKYTSIKTAKVILDN-SGYTKGYGFVRFGNEDEQRNALY 237 S+ V +L D L R F ++ +K + D +G +G+GF++F + + A + Sbjct: 38 SLLVRNLRHDCRQEDLRRPF-EQFGPVKDIYLPRDYYTGDPRGFGFIQFMDPADAAEAKH 96 Query: 238 AMNGYCGLG 264 M+GY LG Sbjct: 97 QMDGYLLLG 105 >At2g44710.1 68415.m05564 RNA recognition motif (RRM)-containing protein Length = 809 Score = 28.3 bits (60), Expect = 2.1 Identities = 20/76 (26%), Positives = 36/76 (47%), Gaps = 6/76 (7%) Frame = +1 Query: 25 ETRANMQHER----EFSVWVGDLSPDVDDYSLYRVF--ASKYTSIKTAKVILDNSGYTKG 186 E ++ HER EF ++VG L + L +VF + T ++ K + +KG Sbjct: 199 EEHHDVLHERRKRKEFEIFVGSLDKGASEEDLKKVFGHVGEVTEVRILK--NPQTKKSKG 256 Query: 187 YGFVRFGNEDEQRNAL 234 F+RF ++ + A+ Sbjct: 257 SAFLRFATVEQAKRAV 272 >At2g22100.1 68415.m02625 RNA recognition motif (RRM)-containing protein similar to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains Pfam profile: PF00076 RNA recognition motif (aka RRM, RBD, or RNP domain) Length = 382 Score = 27.9 bits (59), Expect = 2.8 Identities = 19/59 (32%), Positives = 28/59 (47%), Gaps = 1/59 (1%) Frame = +1 Query: 61 SVWVGDLSPDVDDYSLYRVFASKYTSIKTAKVILD-NSGYTKGYGFVRFGNEDEQRNAL 234 +++V L D +L F Y I V++D ++G KG+GFV F R AL Sbjct: 164 NIFVRGLGWDTTHENLKAAF-EVYGEITECSVVMDKDTGRAKGFGFVLFKTRKGARAAL 221 >At1g55310.1 68414.m06318 SC35-like splicing factor, 33 kD (SCL33) nearly identical to SC35-like splicing factor SCL33, 33 kD [Arabidopsis thaliana] GI:9843659 Length = 220 Score = 27.9 bits (59), Expect = 2.8 Identities = 12/32 (37%), Positives = 21/32 (65%) Frame = +1 Query: 169 SGYTKGYGFVRFGNEDEQRNALYAMNGYCGLG 264 +G +G+GFV+F + + +A + M+GY LG Sbjct: 73 TGDPRGFGFVQFMDPADAADAKHHMDGYLLLG 104 >At3g06970.1 68416.m00828 RNA recognition motif (RRM)-containing protein contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 272 Score = 27.5 bits (58), Expect = 3.7 Identities = 17/60 (28%), Positives = 30/60 (50%), Gaps = 1/60 (1%) Frame = +1 Query: 28 TRANMQHEREFSVWVGDLSPDVDDYSLYRVFASKYTSIKTAKVILDN-SGYTKGYGFVRF 204 ++ N R ++VG+L+ L R F ++ + A V+ + G +KGYGF+ F Sbjct: 2 SQTNNHDTRVTKIFVGNLTWRTTADDLRRYF-EQFGQVVDANVVSETYPGRSKGYGFITF 60 >At5g07290.1 68418.m00832 RNA recognition motif (RRM)-containing protein Mei2-like protein - Arabidopsis thaliana, EMBL:D86122 Length = 907 Score = 27.1 bits (57), Expect = 4.8 Identities = 19/89 (21%), Positives = 42/89 (47%) Frame = +1 Query: 43 QHEREFSVWVGDLSPDVDDYSLYRVFASKYTSIKTAKVILDNSGYTKGYGFVRFGNEDEQ 222 ++ E ++WV +L + + L+ +F+S Y I+ + + + ++ F + + Sbjct: 290 ENSSEGALWVNNLDSSISNEELHGIFSS-YGEIREVRRTMHENSQV----YIEFFDVRKA 344 Query: 223 RNALYAMNGYCGLGTKPLKICTAVPKPKS 309 + AL +NG G + LK+ P+ S Sbjct: 345 KVALQGLNGLEVAG-RQLKLAPTCPEGTS 372 >At4g33890.2 68417.m04809 expressed protein Length = 342 Score = 27.1 bits (57), Expect = 4.8 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = +1 Query: 139 IKTAKVILDNSGYTKGYGFVRFGNEDEQRNA 231 IK A + KG FVRFGN D ++N+ Sbjct: 72 IKNACIAKSPPFIKKGGSFVRFGNGDSKKNS 102 >At4g33890.1 68417.m04808 expressed protein Length = 342 Score = 27.1 bits (57), Expect = 4.8 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = +1 Query: 139 IKTAKVILDNSGYTKGYGFVRFGNEDEQRNA 231 IK A + KG FVRFGN D ++N+ Sbjct: 72 IKNACIAKSPPFIKKGGSFVRFGNGDSKKNS 102 >At3g48210.1 68416.m05260 expressed protein Length = 315 Score = 27.1 bits (57), Expect = 4.8 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = -1 Query: 117 HSIKRVIINVRA*VSNPNREFSFMLHIGS 31 H +K N+ A P REFSF +H G+ Sbjct: 170 HGVKFTFTNIDA--KRPTREFSFTVHYGN 196 >At2g43410.1 68415.m05395 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 1056 Score = 27.1 bits (57), Expect = 4.8 Identities = 19/72 (26%), Positives = 34/72 (47%) Frame = +1 Query: 61 SVWVGDLSPDVDDYSLYRVFASKYTSIKTAKVILDNSGYTKGYGFVRFGNEDEQRNALYA 240 ++WVG L+P+ + L +F +Y I V ++G+ F+ + + +E A A Sbjct: 19 NLWVGSLTPETTESDLTELF-GRYGDIDRITVY-----SSRGFAFIYYRHVEEAVAAKEA 72 Query: 241 MNGYCGLGTKPL 276 + G GT L Sbjct: 73 LQGANLNGTNEL 84 >At1g73530.1 68414.m08511 RNA recognition motif (RRM)-containing protein low similarity to SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) {Arabidopsis thaliana}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 181 Score = 27.1 bits (57), Expect = 4.8 Identities = 18/82 (21%), Positives = 40/82 (48%), Gaps = 1/82 (1%) Frame = +1 Query: 7 LNTASRETRANMQHEREFSVWVGDLSPDVDDYSLYRVFASKYTSIKTAKVILDN-SGYTK 183 L+T S + + + ++V LS + +L F ++ ++ +++D + K Sbjct: 60 LSTDSSSSPPSSSSGPKTKLYVSGLSFRTTEDTLRDTF-EQFGNLIHMNMVMDKVANRPK 118 Query: 184 GYGFVRFGNEDEQRNALYAMNG 249 G+ F+R+ E+E A+ M+G Sbjct: 119 GFAFLRYETEEEAMKAIQGMHG 140 >At2g22090.2 68415.m02624 UBP1 interacting protein 1a (UBA1a) nearly identical to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); based on cDNA of partial mRNA for UBP1 interacting protein 1a (uba1a) GI:19574235 Length = 347 Score = 26.6 bits (56), Expect = 6.4 Identities = 13/36 (36%), Positives = 19/36 (52%), Gaps = 1/36 (2%) Frame = +1 Query: 130 YTSIKTAKVILDNS-GYTKGYGFVRFGNEDEQRNAL 234 Y I+ V++D + G KG+GFV F + AL Sbjct: 127 YGEIEECTVVIDKATGKAKGFGFVMFKTRKGAKEAL 162 >At2g22090.1 68415.m02623 UBP1 interacting protein 1a (UBA1a) nearly identical to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); based on cDNA of partial mRNA for UBP1 interacting protein 1a (uba1a) GI:19574235 Length = 343 Score = 26.6 bits (56), Expect = 6.4 Identities = 13/36 (36%), Positives = 19/36 (52%), Gaps = 1/36 (2%) Frame = +1 Query: 130 YTSIKTAKVILDNS-GYTKGYGFVRFGNEDEQRNAL 234 Y I+ V++D + G KG+GFV F + AL Sbjct: 127 YGEIEECTVVIDKATGKAKGFGFVMFKTRKGAKEAL 162 >At1g09140.1 68414.m01018 SF2/ASF-like splicing modulator (SRP30) nearly identical to SF2/ASF-like splicing modulator Srp30 [Arabidopsis thaliana] GI:4775270 Length = 268 Score = 26.6 bits (56), Expect = 6.4 Identities = 18/64 (28%), Positives = 31/64 (48%) Frame = +1 Query: 61 SVWVGDLSPDVDDYSLYRVFASKYTSIKTAKVILDNSGYTKGYGFVRFGNEDEQRNALYA 240 +++VG+L D+ + +F KY I + L GY FV F + + +A+Y Sbjct: 8 TIYVGNLPGDIRKCEVEDLFY-KYGPI--VDIDLKIPPRPPGYAFVEFEDPRDADDAIYG 64 Query: 241 MNGY 252 +GY Sbjct: 65 RDGY 68 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.135 0.415 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,027,481 Number of Sequences: 28952 Number of extensions: 151785 Number of successful extensions: 537 Number of sequences better than 10.0: 131 Number of HSP's better than 10.0 without gapping: 461 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 513 length of database: 12,070,560 effective HSP length: 74 effective length of database: 9,928,112 effective search space used: 605614832 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -