BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS313C06f (521 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g72050.2 68414.m08328 zinc finger (C2H2 type) family protein ... 32 0.20 At2g23100.1 68415.m02756 DC1 domain-containing protein contains ... 30 0.82 At2g02700.1 68415.m00210 DC1 domain-containing protein contains ... 30 0.82 At1g72050.1 68414.m08329 zinc finger (C2H2 type) family protein ... 29 1.4 At4g14920.1 68417.m02292 PHD finger transcription factor, putative 29 2.5 At3g48340.1 68416.m05276 cysteine proteinase, putative similar t... 29 2.5 At5g51200.1 68418.m06349 expressed protein 28 3.3 At4g02200.2 68417.m00295 drought-responsive family protein simil... 28 3.3 At4g02200.1 68417.m00294 drought-responsive family protein simil... 28 3.3 At3g60300.1 68416.m06740 RWD domain-containing protein contains ... 28 3.3 At5g66610.1 68418.m08396 LIM domain-containing protein contains ... 28 4.4 At1g79280.1 68414.m09242 expressed protein weak similarity to Nu... 28 4.4 At1g43860.1 68414.m05053 expressed protein 28 4.4 At3g46810.1 68416.m05081 DC1 domain-containing protein contains ... 27 5.8 At2g33385.1 68415.m04092 actin-related protein 2/3 complex 34kDa... 27 5.8 At1g62310.1 68414.m07031 transcription factor jumonji (jmjC) dom... 27 5.8 At3g27473.1 68416.m03434 DC1 domain-containing protein contains ... 27 7.7 At2g39260.1 68415.m04821 MIF4G domain-containing protein similar... 27 7.7 At1g60720.1 68414.m06835 hypothetical protein 27 7.7 >At1g72050.2 68414.m08328 zinc finger (C2H2 type) family protein contains multiple zinc finger domains: PF00096: Zinc finger, C2H2 type Length = 412 Score = 32.3 bits (70), Expect = 0.20 Identities = 19/71 (26%), Positives = 32/71 (45%), Gaps = 2/71 (2%) Frame = +1 Query: 307 RKKYCRLCQKPISLHYFVS-HLRRVHQRGPNEEKIDQANLINVNKDSFENCPICEKLVHK 483 R C+ C S +Y ++ H++ HQ EE+ D+A ++ S C C K Sbjct: 18 RNYLCQYCGISRSKNYLITKHIQSHHQMELEEERDDEACEVDEESSSNHTCQECGAEFKK 77 Query: 484 SKY-KEHLADH 513 + K+H+ H Sbjct: 78 PAHLKQHMQSH 88 Score = 29.5 bits (63), Expect = 1.4 Identities = 16/56 (28%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +1 Query: 217 IECNICKKYIMKTYIKYHMKMHGPETERAERKKYCRLCQKPIS-LHYFVSHLRRVH 381 I C IC +K IK H++ H ++ E K C S H++ VH Sbjct: 275 INCEICGSKHLKKNIKRHLRTHDEDSSPGEIKCEVEGCSSTFSKASNLQKHMKAVH 330 >At2g23100.1 68415.m02756 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 711 Score = 30.3 bits (65), Expect = 0.82 Identities = 12/28 (42%), Positives = 19/28 (67%) Frame = +1 Query: 268 HMKMHGPETERAERKKYCRLCQKPISLH 351 H+K+ G + R E KK+C+ C PIS++ Sbjct: 407 HLKLQGKGSHRGE-KKFCKACCFPISIY 433 >At2g02700.1 68415.m00210 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 499 Score = 30.3 bits (65), Expect = 0.82 Identities = 24/97 (24%), Positives = 41/97 (42%), Gaps = 6/97 (6%) Frame = +1 Query: 211 GKIECNICKKYIMKTYIKYHMKM-HGPETERAERKKYCRL----CQKPISLHY-FVSHLR 372 G CN+CK Y + T + G E E K L I LH+ H++ Sbjct: 307 GAYSCNVCKDYAVHTRCALRKDIWDGIELEGVPEDKDVELPFYRIADGIILHFSHGCHMK 366 Query: 373 RVHQRGPNEEKIDQANLINVNKDSFENCPICEKLVHK 483 E + QA ++ +N+++F C C+ ++H+ Sbjct: 367 FETNGVYKENEFCQACVLPINEENFYVCVKCDFILHE 403 >At1g72050.1 68414.m08329 zinc finger (C2H2 type) family protein contains multiple zinc finger domains: PF00096: Zinc finger, C2H2 type Length = 324 Score = 29.5 bits (63), Expect = 1.4 Identities = 16/56 (28%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +1 Query: 217 IECNICKKYIMKTYIKYHMKMHGPETERAERKKYCRLCQKPIS-LHYFVSHLRRVH 381 I C IC +K IK H++ H ++ E K C S H++ VH Sbjct: 187 INCEICGSKHLKKNIKRHLRTHDEDSSPGEIKCEVEGCSSTFSKASNLQKHMKAVH 242 >At4g14920.1 68417.m02292 PHD finger transcription factor, putative Length = 1055 Score = 28.7 bits (61), Expect = 2.5 Identities = 14/50 (28%), Positives = 27/50 (54%) Frame = +1 Query: 7 HIEQYQCGMCSMISETLDKLEIHCELNHNIKVTDTMKCDVCKEDVSVAIQ 156 H+ ++Q GMC + ++ + ++ K+TD+ CD C E + AI+ Sbjct: 881 HVYRHQ-GMCRRLFSVVESVSSTADV---AKLTDSFYCDPCNEGTNSAIK 926 >At3g48340.1 68416.m05276 cysteine proteinase, putative similar to cysteine endopeptidase precursor [Ricinus communis] GI:2944446; contains Pfam profile PF00112: Papain family cysteine protease Length = 351 Score = 28.7 bits (61), Expect = 2.5 Identities = 14/48 (29%), Positives = 22/48 (45%), Gaps = 1/48 (2%) Frame = +1 Query: 151 IQHIHMKQHKDE-YKRKRRKVGKIECNICKKYIMKTYIKYHMKMHGPE 291 + H+H K+ YK K K + N K + IK+H + GP+ Sbjct: 65 VMHVHNTNKKNRSYKLKLNKFADLTINEFKNAYTGSNIKHHRMLQGPK 112 >At5g51200.1 68418.m06349 expressed protein Length = 1808 Score = 28.3 bits (60), Expect = 3.3 Identities = 13/34 (38%), Positives = 21/34 (61%), Gaps = 2/34 (5%) Frame = +1 Query: 7 HIEQYQCGMCSMISETLDKLEIHCE--LNHNIKV 102 HI+Q +C +S T+D+L + E + HN+KV Sbjct: 1758 HIQQEVTDLCGKLSPTIDRLALLNEGKVGHNLKV 1791 >At4g02200.2 68417.m00295 drought-responsive family protein similar to drought-induced mRNA, Di19 [Arabidopsis thaliana] gi|469110|emb|CAA55321 Length = 207 Score = 28.3 bits (60), Expect = 3.3 Identities = 17/57 (29%), Positives = 28/57 (49%), Gaps = 3/57 (5%) Frame = +1 Query: 34 CSMISETLDKLEI--HCELNHNIKVTDTMKCDVCKEDVSV-AIQHIHMKQHKDEYKR 195 C S+ D +E+ H + H + + + C VC V + + HI QH+D +KR Sbjct: 45 CPFCSDDYDLVELCHHIDEEHQLDANNGI-CPVCSRRVKMHMVDHI-TTQHRDVFKR 99 >At4g02200.1 68417.m00294 drought-responsive family protein similar to drought-induced mRNA, Di19 [Arabidopsis thaliana] gi|469110|emb|CAA55321 Length = 214 Score = 28.3 bits (60), Expect = 3.3 Identities = 17/57 (29%), Positives = 28/57 (49%), Gaps = 3/57 (5%) Frame = +1 Query: 34 CSMISETLDKLEI--HCELNHNIKVTDTMKCDVCKEDVSV-AIQHIHMKQHKDEYKR 195 C S+ D +E+ H + H + + + C VC V + + HI QH+D +KR Sbjct: 45 CPFCSDDYDLVELCHHIDEEHQLDANNGI-CPVCSRRVKMHMVDHI-TTQHRDVFKR 99 >At3g60300.1 68416.m06740 RWD domain-containing protein contains weak similarity to RING finger protein 25 (RING finger protein AO7) (Swiss-Prot:Q9QZR0) [Mus musculus] Length = 366 Score = 28.3 bits (60), Expect = 3.3 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = +1 Query: 442 SFENCPICEKLVHKSKYKEHLAD 510 S NCP+C K+ H S EH+ D Sbjct: 195 SLGNCPVCRKIFHSSDI-EHVLD 216 >At5g66610.1 68418.m08396 LIM domain-containing protein contains Pfam profile PF00412: LIM domain Length = 529 Score = 27.9 bits (59), Expect = 4.4 Identities = 12/39 (30%), Positives = 18/39 (46%) Frame = +1 Query: 250 KTYIKYHMKMHGPETERAERKKYCRLCQKPISLHYFVSH 366 K+ I+Y +H CR C KPI++H + H Sbjct: 205 KSAIEYGRSVHALGVNWHPECFCCRYCDKPIAMHEYKEH 243 >At1g79280.1 68414.m09242 expressed protein weak similarity to Nucleoprotein TPR (Swiss-Prot:P12270) [Homo sapiens] Length = 2111 Score = 27.9 bits (59), Expect = 4.4 Identities = 22/111 (19%), Positives = 49/111 (44%), Gaps = 4/111 (3%) Frame = +1 Query: 79 ELNHNIKVTD--TMKCDVCKEDVSVAIQHIHMKQHKDEYKRKRRKVGKIECNI--CKKYI 246 E NI + D +K +V + + + + H + K K+ K+ +E + CKK + Sbjct: 1367 ETYRNIDIADYNRLKDEVRQLEEKLKAKDAHAEDCKKVLLEKQNKISLLEKELTNCKKDL 1426 Query: 247 MKTYIKYHMKMHGPETERAERKKYCRLCQKPISLHYFVSHLRRVHQRGPNE 399 + + T ++E K + +K +HY ++ +R +++ +E Sbjct: 1427 SEREKRLDDAQQAQATMQSEFNKQKQELEKNKKIHYTLNMTKRKYEKEKDE 1477 >At1g43860.1 68414.m05053 expressed protein Length = 370 Score = 27.9 bits (59), Expect = 4.4 Identities = 18/47 (38%), Positives = 21/47 (44%), Gaps = 3/47 (6%) Frame = +1 Query: 115 KCDVCKEDVSVAIQHI-HMKQ--HKDEYKRKRRKVGKIECNICKKYI 246 KC C V A Q+ H K HK KRK RK+ I + C I Sbjct: 310 KCSTCNTFVGEAKQYREHCKSDWHKHNLKRKTRKLPPISADECMSEI 356 >At3g46810.1 68416.m05081 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 686 Score = 27.5 bits (58), Expect = 5.8 Identities = 8/19 (42%), Positives = 14/19 (73%) Frame = +1 Query: 307 RKKYCRLCQKPISLHYFVS 363 R++ C LC++P+ + YF S Sbjct: 74 RRQRCHLCERPVGIGYFCS 92 >At2g33385.1 68415.m04092 actin-related protein 2/3 complex 34kDa subunit family / arp2/3 complex 34kDa subunit family low similarity to SP|O15144| ARP2/3 complex 34 kDa subunit (P34-ARC) (Actin-related protein 2/3 complex subunit 2) {Homo sapiens}; contains Pfam profile PF04045: Arp2/3 complex, 34 kD subunit p34-Arc Length = 365 Score = 27.5 bits (58), Expect = 5.8 Identities = 22/67 (32%), Positives = 30/67 (44%), Gaps = 2/67 (2%) Frame = +1 Query: 49 ETLDKLEIHCELNHNIKVTDTMKCDVCKEDVSVAIQHIHMKQHKDEYKRKRRKVGK--IE 222 ETL KL + L + +C KE V V + MKQ E R R K+ K I+ Sbjct: 275 ETLVKLLNNTSLEEEAAQNENGRCKYVKEFVKVPKGKLMMKQRCKEMTR-RVKISKFRIK 333 Query: 223 CNICKKY 243 N C ++ Sbjct: 334 INGCARF 340 >At1g62310.1 68414.m07031 transcription factor jumonji (jmjC) domain-containing protein similar to nuclear protein 5qNCA [Homo sapiens] GI:13161188; contains Pfam profile PF02373: jmjC domain Length = 883 Score = 27.5 bits (58), Expect = 5.8 Identities = 15/51 (29%), Positives = 30/51 (58%), Gaps = 1/51 (1%) Frame = +3 Query: 237 KIYYENLYQISYENAWSGN*KSRKKKIL-PFVPKANIVTLFCQSPEKSTSK 386 K+ + N +Q+SY+ +W+ +RKK+ L PF+ K + + S ++ S+ Sbjct: 6 KLEHMNCFQLSYQYSWT----TRKKRTLKPFMSKGSSPSSSSDSRKRKLSR 52 >At3g27473.1 68416.m03434 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 662 Score = 27.1 bits (57), Expect = 7.7 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = -2 Query: 520 AYRDQLDVLCTLICAPIFH 464 +YRD+ D+LC+ I P H Sbjct: 463 SYRDKFDLLCSSITVPFIH 481 >At2g39260.1 68415.m04821 MIF4G domain-containing protein similar to hUPF2 [Homo sapiens] GI:12232320; contains Pfam profile PF02854: MIF4G domain Length = 1186 Score = 27.1 bits (57), Expect = 7.7 Identities = 10/36 (27%), Positives = 21/36 (58%) Frame = +1 Query: 178 KDEYKRKRRKVGKIECNICKKYIMKTYIKYHMKMHG 285 KD +++ K+ + C++YI+K ++K H +G Sbjct: 683 KDSIANVLKQLRKLPWSECEQYILKCFMKVHKGKYG 718 >At1g60720.1 68414.m06835 hypothetical protein Length = 289 Score = 27.1 bits (57), Expect = 7.7 Identities = 9/25 (36%), Positives = 16/25 (64%) Frame = +1 Query: 7 HIEQYQCGMCSMISETLDKLEIHCE 81 HI+ + C +C++ +E+ D L CE Sbjct: 163 HIQSFDCCLCTIETESRDHLLFSCE 187 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,323,496 Number of Sequences: 28952 Number of extensions: 204947 Number of successful extensions: 699 Number of sequences better than 10.0: 19 Number of HSP's better than 10.0 without gapping: 656 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 699 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 957410176 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -