BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS313C05f (499 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC15D4.07c |atg9|apg9|autophagy associated protein Atg9 |Schiz... 25 6.3 SPAC17D4.01 |pex7|SPAC1834.12|peroxin-7 |Schizosaccharomyces pom... 25 8.4 >SPBC15D4.07c |atg9|apg9|autophagy associated protein Atg9 |Schizosaccharomyces pombe|chr 2|||Manual Length = 702 Score = 25.0 bits (52), Expect = 6.3 Identities = 12/39 (30%), Positives = 24/39 (61%), Gaps = 2/39 (5%) Frame = -1 Query: 121 TWILKCVTFP*--PNGSGSGKGLARLMATVAARTKMILW 11 T+I C+ +P P+GS +G ++ +A ++ T ++LW Sbjct: 221 TFITSCIDWPAVTPHGSLAGVTKSQCIAQMSPITYLVLW 259 >SPAC17D4.01 |pex7|SPAC1834.12|peroxin-7 |Schizosaccharomyces pombe|chr 1|||Manual Length = 308 Score = 24.6 bits (51), Expect = 8.4 Identities = 16/49 (32%), Positives = 21/49 (42%) Frame = -1 Query: 493 SRKATXFHIKNQILILDWKMNFHEHVSLVXNXNXL*RSSFLNTPLQTPL 347 S K I NQI ++W + H V N N + N L+TPL Sbjct: 180 SDKFMSIEIPNQITCMNWSKSNHRMVYTADNNNLVYCYDIAN--LKTPL 226 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,870,902 Number of Sequences: 5004 Number of extensions: 31876 Number of successful extensions: 73 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 68 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 72 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 196153982 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -