BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS313C04f (521 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ292755-1|CAC00630.1| 837|Anopheles gambiae integrin beta subu... 26 0.88 AY578801-1|AAT07306.1| 506|Anopheles gambiae dSmad2 protein. 23 4.7 >AJ292755-1|CAC00630.1| 837|Anopheles gambiae integrin beta subunit protein. Length = 837 Score = 25.8 bits (54), Expect = 0.88 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = +1 Query: 418 PDCLMVYKYISIWPLCPKSN*TLQKIMSANVT 513 P C+ Y Y ++ PL +N Q++ ANV+ Sbjct: 238 PGCVAPYGYHNLMPLSTDANLFSQEVQRANVS 269 >AY578801-1|AAT07306.1| 506|Anopheles gambiae dSmad2 protein. Length = 506 Score = 23.4 bits (48), Expect = 4.7 Identities = 14/49 (28%), Positives = 24/49 (48%) Frame = -2 Query: 184 SAVKHSSPKRLGQPICSKTVEISTSCLKEGAGTYLLGDVNGLWLVTTQY 38 S + S ++L QP+ + ++ E + TY L D++ V TQY Sbjct: 142 SPQQQQSSQQLQQPLTILVPKNLSNSQGENSVTYTLDDLSNTVPVNTQY 190 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 572,757 Number of Sequences: 2352 Number of extensions: 11887 Number of successful extensions: 13 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 47783067 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -