BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS313C03f (521 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF222291-1|ABN79651.1| 374|Tribolium castaneum cardioactive pep... 22 2.9 AM292357-1|CAL23169.2| 355|Tribolium castaneum gustatory recept... 21 5.0 DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 prot... 21 8.7 >EF222291-1|ABN79651.1| 374|Tribolium castaneum cardioactive peptide receptor 1 protein. Length = 374 Score = 22.2 bits (45), Expect = 2.9 Identities = 7/17 (41%), Positives = 11/17 (64%) Frame = -1 Query: 437 LRGPSRMFSTWERGRYL 387 +R P + +W+R RYL Sbjct: 126 IRHPMKFSGSWKRARYL 142 >AM292357-1|CAL23169.2| 355|Tribolium castaneum gustatory receptor candidate 36 protein. Length = 355 Score = 21.4 bits (43), Expect = 5.0 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = -1 Query: 188 SVWSTAGTRLVYRTCRSN*SGSTKRKWGCYQ 96 ++++T GT L+ TC S S K CY+ Sbjct: 264 ALFNTFGTILLIMTCSGVHSESQKLVGVCYE 294 >DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 protein. Length = 980 Score = 20.6 bits (41), Expect = 8.7 Identities = 8/33 (24%), Positives = 18/33 (54%) Frame = -3 Query: 222 ELRSMTQGKGEFSMEYSRYSPCLPDVQEQLIRK 124 ELR +++GK +++ + + + + E I K Sbjct: 454 ELRGISRGKNAKDVDWQKIAGAVEEDDEDAIEK 486 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 100,144 Number of Sequences: 336 Number of extensions: 1775 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12573240 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -