BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS313C01f (521 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_UPI0000F2B380 Cluster: PREDICTED: similar to Chain B, C... 139 3e-32 UniRef50_P62837 Cluster: Ubiquitin-conjugating enzyme E2 D2 (EC ... 139 3e-32 UniRef50_Q7SXH5 Cluster: Ubiquitin carrier protein; n=9; Eukaryo... 132 4e-30 UniRef50_A6NLF6 Cluster: Ubiquitin carrier protein; n=4; Eutheri... 131 8e-30 UniRef50_P35132 Cluster: SUMO-conjugating enzyme UBC9; n=75; Euk... 121 1e-26 UniRef50_A2YZH4 Cluster: Ubiquitin carrier protein; n=3; Spermat... 115 6e-25 UniRef50_UPI000066142F Cluster: Homolog of Brachydanio rerio "Ub... 89 5e-24 UniRef50_Q96LR5 Cluster: Ubiquitin-conjugating enzyme E2 E2; n=1... 94 2e-18 UniRef50_Q5KIQ6 Cluster: Ubiquitin carrier protein; n=1; Filobas... 92 6e-18 UniRef50_UPI00015B555D Cluster: PREDICTED: similar to ubiquitin-... 92 8e-18 UniRef50_Q9I7T6 Cluster: Ubiquitin carrier protein; n=5; Eukaryo... 89 8e-17 UniRef50_Q0DBY7 Cluster: Os06g0506600 protein; n=1; Oryza sativa... 85 7e-16 UniRef50_Q9C8X7 Cluster: Putative ubiquitin conjugating enzyme; ... 84 2e-15 UniRef50_A0C0C6 Cluster: Chromosome undetermined scaffold_14, wh... 83 3e-15 UniRef50_Q8SQR1 Cluster: Ubiquitin carrier protein; n=1; Encepha... 82 7e-15 UniRef50_P61088 Cluster: Ubiquitin-conjugating enzyme E2 N; n=12... 82 9e-15 UniRef50_Q9VYN3 Cluster: Ubiquitin carrier protein; n=2; Sophoph... 81 1e-14 UniRef50_Q54IK3 Cluster: Ubiquitin carrier protein; n=1; Dictyos... 81 2e-14 UniRef50_P35128 Cluster: Ubiquitin-conjugating enzyme E2-17 kDa;... 80 3e-14 UniRef50_Q9LJD7 Cluster: Constitutive photomorphogenesis protein... 80 3e-14 UniRef50_Q54P16 Cluster: Ubiquitin conjugating enzyme; n=2; Dict... 79 8e-14 UniRef50_Q4PH88 Cluster: Ubiquitin carrier protein; n=3; Dikarya... 78 1e-13 UniRef50_Q5CQL8 Cluster: Ubiquitin carrier protein; n=2; Cryptos... 78 1e-13 UniRef50_A0E347 Cluster: Ubiquitin carrier protein; n=4; Eukaryo... 77 2e-13 UniRef50_A2F262 Cluster: Ubiquitin carrier protein; n=3; Eukaryo... 76 4e-13 UniRef50_Q0IF72 Cluster: Ubiquitin-conjugating enzyme morgue; n=... 75 1e-12 UniRef50_A0E1Q4 Cluster: Ubiquitin carrier protein; n=6; Eukaryo... 74 2e-12 UniRef50_P21734 Cluster: Ubiquitin-conjugating enzyme E2-24 kDa;... 74 2e-12 UniRef50_Q0JLE6 Cluster: Ubiquitin carrier protein; n=4; Magnoli... 73 4e-12 UniRef50_A2YII6 Cluster: Ubiquitin carrier protein; n=5; Eukaryo... 73 5e-12 UniRef50_A7RL90 Cluster: Predicted protein; n=2; Nematostella ve... 73 5e-12 UniRef50_UPI0000519DF4 Cluster: PREDICTED: similar to modifier o... 72 7e-12 UniRef50_Q00WD5 Cluster: Chromosome 14 contig 1, DNA sequence; n... 72 9e-12 UniRef50_Q54J12 Cluster: Ubiquitin carrier protein; n=1; Dictyos... 71 1e-11 UniRef50_A7Q2F7 Cluster: Chromosome chr1 scaffold_46, whole geno... 71 2e-11 UniRef50_Q9LQI1 Cluster: F15O4.3; n=1; Arabidopsis thaliana|Rep:... 70 3e-11 UniRef50_Q8LC61 Cluster: E2, ubiquitin-conjugating enzyme, putat... 69 5e-11 UniRef50_A2WYK3 Cluster: Ubiquitin carrier protein; n=2; Oryza s... 69 5e-11 UniRef50_A0CH05 Cluster: Chromosome undetermined scaffold_18, wh... 69 5e-11 UniRef50_UPI00015B43E7 Cluster: PREDICTED: similar to ubiquitin-... 69 7e-11 UniRef50_Q43780 Cluster: Ubiquitin carrier protein; n=15; Eukary... 69 7e-11 UniRef50_Q9LV54 Cluster: Ubiquitin carrier protein; n=2; Arabido... 69 9e-11 UniRef50_UPI0000ECA0A1 Cluster: Ubiquitin-conjugating enzyme E2 ... 68 2e-10 UniRef50_Q9Y165 Cluster: CG15437-PA; n=4; Sophophora|Rep: CG1543... 65 8e-10 UniRef50_P61086 Cluster: Ubiquitin-conjugating enzyme E2-25 kDa ... 65 8e-10 UniRef50_Q7QT23 Cluster: Ubiquitin carrier protein; n=1; Giardia... 65 1e-09 UniRef50_A2EY78 Cluster: Ubiquitin carrier protein; n=1; Trichom... 65 1e-09 UniRef50_Q9NPD8 Cluster: Ubiquitin-conjugating enzyme E2 T; n=16... 65 1e-09 UniRef50_A3AAT7 Cluster: Putative uncharacterized protein; n=4; ... 64 1e-09 UniRef50_Q54F00 Cluster: Ubiquitin carrier protein; n=3; Eukaryo... 64 1e-09 UniRef50_Q9FI61 Cluster: Ubiquitin carrier protein; n=3; Viridip... 64 2e-09 UniRef50_Q4YK13 Cluster: Ubiquitin carrier protein; n=2; Alveola... 64 2e-09 UniRef50_Q9UTN8 Cluster: Ubiquitin conjugating enzyme Ubc14; n=1... 64 2e-09 UniRef50_Q4PGW5 Cluster: Ubiquitin carrier protein; n=2; Basidio... 63 3e-09 UniRef50_A3FPP4 Cluster: Ubiquitin carrier protein; n=1; Cryptos... 62 6e-09 UniRef50_A2F2A5 Cluster: Ubiquitin carrier protein; n=1; Trichom... 62 6e-09 UniRef50_P25153 Cluster: Ubiquitin-conjugating enzyme E2-17 kDa;... 62 6e-09 UniRef50_UPI00006CC0C2 Cluster: Ubiquitin-conjugating enzyme fam... 62 7e-09 UniRef50_Q57XM0 Cluster: Ubiquitin carrier protein; n=1; Trypano... 62 7e-09 UniRef50_Q4WU34 Cluster: Ubiquitin carrier protein; n=16; Pezizo... 62 1e-08 UniRef50_UPI00005A4DED Cluster: PREDICTED: similar to ubiquitin-... 61 1e-08 UniRef50_Q8SRC0 Cluster: Ubiquitin carrier protein; n=1; Encepha... 61 1e-08 UniRef50_A0BKX8 Cluster: Chromosome undetermined scaffold_113, w... 61 2e-08 UniRef50_Q4RS31 Cluster: Ubiquitin carrier protein; n=1; Tetraod... 60 2e-08 UniRef50_Q8WXB3 Cluster: Ubiquitin carrier protein; n=8; Bilater... 60 2e-08 UniRef50_A6NGR2 Cluster: Uncharacterized protein UBE2A (Ubiquiti... 60 2e-08 UniRef50_P63146 Cluster: Ubiquitin-conjugating enzyme E2 B; n=55... 60 2e-08 UniRef50_Q4DVH2 Cluster: Ubiquitin carrier protein; n=2; Trypano... 60 3e-08 UniRef50_Q2H4J3 Cluster: Putative uncharacterized protein; n=2; ... 60 3e-08 UniRef50_A5DB66 Cluster: Ubiquitin carrier protein; n=1; Pichia ... 60 4e-08 UniRef50_Q7QVV7 Cluster: Ubiquitin carrier protein; n=1; Giardia... 59 5e-08 UniRef50_A2F4E2 Cluster: Ubiquitin carrier protein; n=1; Trichom... 59 5e-08 UniRef50_Q0UIW0 Cluster: Putative uncharacterized protein; n=1; ... 59 5e-08 UniRef50_P49428 Cluster: Ubiquitin-conjugating enzyme E2-24 kDa;... 59 5e-08 UniRef50_UPI0000D57489 Cluster: PREDICTED: similar to CG15437-PA... 59 7e-08 UniRef50_A2GNR9 Cluster: Ubiquitin conjugating protein, putative... 59 7e-08 UniRef50_A6SKB5 Cluster: Putative uncharacterized protein; n=2; ... 58 9e-08 UniRef50_A5DY26 Cluster: Ubiquitin carrier protein; n=3; Sacchar... 58 9e-08 UniRef50_P68036 Cluster: Ubiquitin-conjugating enzyme E2 L3; n=6... 58 9e-08 UniRef50_UPI00006CB320 Cluster: Ubiquitin-conjugating enzyme fam... 58 2e-07 UniRef50_Q4WNS9 Cluster: Ubiquitin carrier protein; n=4; Ascomyc... 58 2e-07 UniRef50_P52484 Cluster: Probable ubiquitin-conjugating enzyme E... 58 2e-07 UniRef50_A5E394 Cluster: Putative uncharacterized protein; n=1; ... 57 2e-07 UniRef50_Q4SUR6 Cluster: Ubiquitin carrier protein; n=1; Tetraod... 56 5e-07 UniRef50_A2GLA4 Cluster: Ubiquitin-conjugating enzyme family pro... 56 5e-07 UniRef50_A2D9T6 Cluster: Ubiquitin carrier protein; n=1; Trichom... 56 5e-07 UniRef50_Q7RY50 Cluster: Putative uncharacterized protein NCU045... 56 5e-07 UniRef50_Q6CPL4 Cluster: Kluyveromyces lactis strain NRRL Y-1140... 56 5e-07 UniRef50_Q6C713 Cluster: Similarities with DEHA0D15444g Debaryom... 56 5e-07 UniRef50_P61081 Cluster: NEDD8-conjugating enzyme Ubc12; n=24; E... 56 5e-07 UniRef50_Q8LGF7 Cluster: Ubiquitin carrier protein; n=7; Eukaryo... 56 7e-07 UniRef50_Q5UQC9 Cluster: Probable ubiquitin-conjugating enzyme E... 56 7e-07 UniRef50_UPI00015B62F0 Cluster: PREDICTED: hypothetical protein;... 55 9e-07 UniRef50_Q6LFK4 Cluster: Ubiquitin-conjugating enzyme E2, putati... 55 9e-07 UniRef50_A0CVS4 Cluster: Chromosome undetermined scaffold_295, w... 55 9e-07 UniRef50_Q0R0E6 Cluster: Ubiquitin carrier protein; n=1; Symbiod... 55 1e-06 UniRef50_Q4CQP3 Cluster: Ubiquitin carrier protein; n=4; Trypano... 55 1e-06 UniRef50_A2EHU5 Cluster: Ubiquitin carrier protein; n=1; Trichom... 55 1e-06 UniRef50_Q6BRS6 Cluster: Similarities with CA4803|CaPEX4 Candida... 55 1e-06 UniRef50_UPI0000D56950 Cluster: PREDICTED: similar to Ubiquitin-... 54 2e-06 UniRef50_UPI0000498C2E Cluster: ubiquitin-conjugating enzyme; n=... 54 2e-06 UniRef50_P52491 Cluster: NEDD8-conjugating enzyme UBC12; n=3; Sa... 54 2e-06 UniRef50_Q54TI6 Cluster: Ubiquitin carrier protein; n=1; Dictyos... 54 3e-06 UniRef50_A2E5I6 Cluster: Ubiquitin carrier protein; n=1; Trichom... 54 3e-06 UniRef50_P63279 Cluster: SUMO-conjugating enzyme UBC9; n=74; Euk... 54 3e-06 UniRef50_Q9P6I1 Cluster: Ubiquitin-conjugating enzyme E2 16; n=1... 54 3e-06 UniRef50_A2WTE6 Cluster: Putative uncharacterized protein; n=1; ... 53 3e-06 UniRef50_Q54VW9 Cluster: Ubiquitin carrier protein; n=1; Dictyos... 53 5e-06 UniRef50_Q22BX5 Cluster: Ubiquitin carrier protein; n=5; Tetrahy... 53 5e-06 UniRef50_Q753J8 Cluster: AFR314Wp; n=1; Eremothecium gossypii|Re... 53 5e-06 UniRef50_A7TRY4 Cluster: Putative uncharacterized protein; n=1; ... 53 5e-06 UniRef50_P28263 Cluster: Ubiquitin-conjugating enzyme E2-24 kDa;... 53 5e-06 UniRef50_A0C3F7 Cluster: Ubiquitin carrier protein; n=2; Paramec... 52 6e-06 UniRef50_Q1E8C5 Cluster: Ubiquitin carrier protein; n=9; Pezizom... 52 6e-06 UniRef50_P16577 Cluster: Ubiquitin-conjugating enzyme E2-23 kDa;... 52 6e-06 UniRef50_Q8IJ70 Cluster: Ubiquitin carrier protein; n=9; Aconoid... 52 8e-06 UniRef50_Q4N5Y1 Cluster: Ubiquitin carrier protein; n=3; Piropla... 52 8e-06 UniRef50_P52492 Cluster: Ubiquitin-conjugating enzyme E2-18 kDa;... 52 8e-06 UniRef50_Q9C6Q4 Cluster: Ubiquitin carrier protein; n=10; Eukary... 52 1e-05 UniRef50_A2FAR7 Cluster: Ubiquitin carrier protein; n=1; Trichom... 52 1e-05 UniRef50_A2EP72 Cluster: Ubiquitin carrier protein; n=1; Trichom... 52 1e-05 UniRef50_P42750 Cluster: Ubiquitin-conjugating enzyme E2-21 kDa ... 52 1e-05 UniRef50_Q8I4X8 Cluster: Ubiquitin carrier protein; n=2; Plasmod... 51 1e-05 UniRef50_Q4Y3H7 Cluster: Ubiquitin carrier protein; n=1; Plasmod... 51 1e-05 UniRef50_A7F3W6 Cluster: Putative uncharacterized protein; n=2; ... 51 1e-05 UniRef50_A2DXW4 Cluster: Ubiquitin carrier protein; n=2; Trichom... 51 2e-05 UniRef50_Q5A7Q5 Cluster: Ubiquitin carrier protein; n=2; Ascomyc... 51 2e-05 UniRef50_Q24HQ3 Cluster: Ubiquitin carrier protein; n=1; Tetrahy... 50 2e-05 UniRef50_A2FS62 Cluster: Ubiquitin carrier protein; n=1; Trichom... 50 2e-05 UniRef50_UPI000155BB09 Cluster: PREDICTED: hypothetical protein;... 50 3e-05 UniRef50_Q4QIK2 Cluster: Ubiquitin carrier protein; n=6; Trypano... 50 3e-05 UniRef50_Q4QBT6 Cluster: Ubiquitin-conjugating enzyme-like prote... 50 3e-05 UniRef50_A6NP33 Cluster: Uncharacterized protein UBE2C; n=14; Th... 50 3e-05 UniRef50_Q4PBN3 Cluster: Ubiquitin carrier protein; n=1; Ustilag... 50 3e-05 UniRef50_Q1DRT9 Cluster: Ubiquitin carrier protein; n=1; Coccidi... 50 3e-05 UniRef50_A7TMT8 Cluster: Putative uncharacterized protein; n=1; ... 50 3e-05 UniRef50_A6RMU5 Cluster: Ubiquitin carrier protein; n=6; Ascomyc... 50 3e-05 UniRef50_O00762 Cluster: Ubiquitin-conjugating enzyme E2 C; n=26... 50 3e-05 UniRef50_A3C6U5 Cluster: Ubiquitin carrier protein; n=2; Oryza s... 50 4e-05 UniRef50_Q7QVX4 Cluster: Ubiquitin carrier protein; n=1; Giardia... 50 4e-05 UniRef50_A7ARW5 Cluster: Putative uncharacterized protein; n=1; ... 50 4e-05 UniRef50_A2G420 Cluster: Ubiquitin carrier protein; n=1; Trichom... 50 4e-05 UniRef50_A0CCE4 Cluster: Chromosome undetermined scaffold_167, w... 50 4e-05 UniRef50_A6RUK1 Cluster: Ubiquitin carrier protein; n=2; Sclerot... 50 4e-05 UniRef50_Q7KNM2 Cluster: Ubiquitin carrier protein; n=39; Eukary... 49 6e-05 UniRef50_Q1EB54 Cluster: Ubiquitin-conjugating enzyme; n=7; Pezi... 49 6e-05 UniRef50_P56616 Cluster: Ubiquitin-conjugating enzyme E2 C; n=20... 49 6e-05 UniRef50_Q6C9W0 Cluster: NEDD8-conjugating enzyme UBC12; n=41; E... 49 7e-05 UniRef50_UPI00006CB812 Cluster: Ubiquitin-conjugating enzyme fam... 48 1e-04 UniRef50_UPI000049916F Cluster: ubiquitin-conjugating enzyme; n=... 48 1e-04 UniRef50_Q586X5 Cluster: Ubiquitin carrier protein; n=3; Trypano... 48 1e-04 UniRef50_Q247Y5 Cluster: Ubiquitin carrier protein; n=1; Tetrahy... 48 1e-04 UniRef50_P62256 Cluster: Ubiquitin-conjugating enzyme E2 H; n=51... 48 1e-04 UniRef50_Q95017 Cluster: SUMO-conjugating enzyme UBC9; n=7; Euka... 48 1e-04 UniRef50_A0D4V6 Cluster: Chromosome undetermined scaffold_38, wh... 48 2e-04 UniRef50_A0BIB5 Cluster: Chromosome undetermined scaffold_11, wh... 48 2e-04 UniRef50_Q4Q5L3 Cluster: Ubiquitin carrier protein; n=6; Trypano... 47 2e-04 UniRef50_Q4DY64 Cluster: Ubiquitin-conjugating enzyme E2, putati... 47 2e-04 UniRef50_Q6MYZ2 Cluster: Ubiquitin carrier protein; n=7; Trichoc... 47 2e-04 UniRef50_Q5YES5 Cluster: Ubiquitin conjugating enzyme E2 2; n=1;... 47 3e-04 UniRef50_Q16763 Cluster: Ubiquitin-conjugating enzyme E2 S; n=33... 47 3e-04 UniRef50_O74549 Cluster: NEDD8-conjugating enzyme ubc12; n=10; D... 47 3e-04 UniRef50_UPI00006CC8BE Cluster: Ubiquitin-conjugating enzyme fam... 46 4e-04 UniRef50_UPI00006064E0 Cluster: PREDICTED: similar to ubiquitin-... 46 4e-04 UniRef50_P60604 Cluster: Ubiquitin-conjugating enzyme E2 G2; n=8... 46 4e-04 UniRef50_Q0R0E7 Cluster: Ubiquitin carrier protein; n=1; Symbiod... 46 5e-04 UniRef50_Q6CSW8 Cluster: NEDD8-conjugating enzyme UBC12; n=1; Kl... 46 5e-04 UniRef50_A2AX45 Cluster: Ubiquitin carrier protein; n=1; Guillar... 46 7e-04 UniRef50_Q9N2W9 Cluster: Ubiquitin carrier protein; n=1; Caenorh... 46 7e-04 UniRef50_Q7QP58 Cluster: GLP_382_4762_5115; n=1; Giardia lamblia... 46 7e-04 UniRef50_A0DYM1 Cluster: Chromosome undetermined scaffold_7, who... 46 7e-04 UniRef50_Q0JAS6 Cluster: Os04g0580400 protein; n=1; Oryza sativa... 45 0.001 UniRef50_Q4Q3Q8 Cluster: Ubiquitin carrier protein; n=4; Leishma... 45 0.001 UniRef50_A4QTE5 Cluster: Predicted protein; n=1; Magnaporthe gri... 45 0.001 UniRef50_Q9VZ73 Cluster: CG17030-PA; n=1; Drosophila melanogaste... 45 0.001 UniRef50_Q5A339 Cluster: Ubiquitin carrier protein; n=2; Eukaryo... 45 0.001 UniRef50_Q4PA94 Cluster: Ubiquitin carrier protein; n=11; Eukary... 45 0.001 UniRef50_A4RG25 Cluster: Putative uncharacterized protein; n=4; ... 45 0.001 UniRef50_P27949 Cluster: Ubiquitin-conjugating enzyme E2-21 kDa;... 45 0.001 UniRef50_Q75AF2 Cluster: NEDD8-conjugating enzyme UBC12; n=2; Er... 45 0.001 UniRef50_A3AAU2 Cluster: Putative uncharacterized protein; n=3; ... 44 0.002 UniRef50_Q18288 Cluster: Ubiquitin conjugating enzyme protein 23... 44 0.002 UniRef50_A4GFM0 Cluster: Peroxin 4; n=1; Penicillium chrysogenum... 44 0.002 UniRef50_A3FQP7 Cluster: Ubiquitin carrier protein; n=2; Cryptos... 44 0.002 UniRef50_Q8SSK8 Cluster: UBIQUITIN CONJUGATING ENZYME E2; n=1; E... 44 0.002 UniRef50_Q5BE71 Cluster: Ubiquitin carrier protein; n=2; Trichoc... 44 0.002 UniRef50_Q55U75 Cluster: Ubiquitin carrier protein; n=2; Filobas... 44 0.002 UniRef50_UPI00015565E9 Cluster: PREDICTED: similar to ubiquitin-... 44 0.003 UniRef50_Q9AW53 Cluster: Ubiquitin carrier protein; n=1; Guillar... 44 0.003 UniRef50_Q0DY15 Cluster: Os02g0721200 protein; n=2; Oryza sativa... 44 0.003 UniRef50_A2EJF5 Cluster: Ubiquitin-conjugating enzyme family pro... 43 0.004 UniRef50_A2EFK5 Cluster: Ubiquitin carrier protein; n=1; Trichom... 43 0.004 UniRef50_A0BMS1 Cluster: Chromosome undetermined scaffold_117, w... 43 0.004 UniRef50_A2EGV7 Cluster: Ubiquitin carrier protein; n=1; Trichom... 43 0.005 UniRef50_A7TP75 Cluster: Putative uncharacterized protein; n=1; ... 43 0.005 UniRef50_Q0JI74 Cluster: Ubiquitin carrier protein; n=2; Oryza s... 42 0.006 UniRef50_Q5DI37 Cluster: Ubiquitin carrier protein; n=2; Schisto... 42 0.006 UniRef50_A2E403 Cluster: Ubiquitin carrier protein; n=1; Trichom... 42 0.009 UniRef50_A0EBF3 Cluster: Ubiquitin carrier protein; n=1; Paramec... 42 0.009 UniRef50_A2QG50 Cluster: Ubiquitin carrier protein; n=1; Aspergi... 42 0.009 UniRef50_Q98S78 Cluster: Ubiquitin-conjugating enzyme E2-17 KD s... 42 0.011 UniRef50_Q4UI29 Cluster: Ubiquitin-conjugating enzyme E2 (RUB1 h... 42 0.011 UniRef50_Q0TZE7 Cluster: Ubiquitin carrier protein; n=1; Phaeosp... 42 0.011 UniRef50_Q5UQ40 Cluster: Putative uncharacterized protein; n=1; ... 41 0.015 UniRef50_Q7QQ94 Cluster: Ubiquitin carrier protein; n=1; Giardia... 41 0.015 UniRef50_A7TL65 Cluster: Putative uncharacterized protein; n=1; ... 41 0.015 UniRef50_P14682 Cluster: Ubiquitin-conjugating enzyme E2-34 kDa;... 41 0.015 UniRef50_UPI00001628C0 Cluster: UBC7 (ubiquitin-conjugating enzy... 41 0.020 UniRef50_P42743 Cluster: Ubiquitin-conjugating enzyme E2-18 kDa;... 41 0.020 UniRef50_Q9FF66 Cluster: Ubiquitin carrier protein; n=8; Viridip... 40 0.035 UniRef50_A2DRC1 Cluster: Ubiquitin carrier protein; n=1; Trichom... 40 0.035 UniRef50_Q8IH42 Cluster: Ubiquitin carrier protein; n=15; Fungi/... 40 0.046 UniRef50_A7RLE1 Cluster: Predicted protein; n=1; Nematostella ve... 40 0.046 UniRef50_Q7SGR9 Cluster: Ubiquitin carrier protein; n=11; Pezizo... 40 0.046 UniRef50_A6SCL8 Cluster: Putative uncharacterized protein; n=1; ... 40 0.046 UniRef50_Q969M7 Cluster: NEDD8-conjugating enzyme UBE2F; n=34; E... 40 0.046 UniRef50_UPI0000498382 Cluster: ubiquitin-conjugating enzyme; n=... 39 0.060 UniRef50_Q7R2Z1 Cluster: Ubiquitin carrier protein; n=1; Giardia... 39 0.060 UniRef50_Q28XJ5 Cluster: GA20189-PA; n=1; Drosophila pseudoobscu... 39 0.060 UniRef50_Q54J27 Cluster: Ubiquitin carrier protein; n=6; Eukaryo... 39 0.080 UniRef50_Q96B02 Cluster: Probable ubiquitin-conjugating enzyme E... 39 0.080 UniRef50_UPI00015B5920 Cluster: PREDICTED: similar to ubiquitin-... 38 0.11 UniRef50_Q54I43 Cluster: Ubiquitin carrier protein; n=3; Eukaryo... 38 0.11 UniRef50_Q6E683 Cluster: Ubiquitin carrier protein; n=1; Antonos... 38 0.11 UniRef50_P62253 Cluster: Ubiquitin-conjugating enzyme E2 G1; n=6... 38 0.11 UniRef50_Q4QAG0 Cluster: Ubiquitin-conjugating enzyme E2, putati... 38 0.14 UniRef50_Q4P8X0 Cluster: Putative uncharacterized protein; n=1; ... 38 0.14 UniRef50_Q5VVX9 Cluster: Ubiquitin-conjugating enzyme E2 U; n=11... 38 0.18 UniRef50_Q4U8F2 Cluster: Ubiquitin carrier protein; n=2; Piropla... 37 0.24 UniRef50_Q6BZP7 Cluster: Similarity; n=1; Yarrowia lipolytica|Re... 37 0.24 UniRef50_UPI000023E382 Cluster: hypothetical protein FG10841.1; ... 37 0.32 UniRef50_Q8SR07 Cluster: UBIQUITIN CONJUGATING ENZYME E2-20K; n=... 37 0.32 UniRef50_A6R4R4 Cluster: Putative uncharacterized protein; n=2; ... 37 0.32 UniRef50_A3LYJ5 Cluster: Predicted protein; n=3; Saccharomycetal... 37 0.32 UniRef50_UPI0000E487EE Cluster: PREDICTED: similar to ubiquitin ... 36 0.43 UniRef50_Q8ILW5 Cluster: Ubiquitin conjugating enzyme, putative;... 36 0.43 UniRef50_Q6FWP7 Cluster: Similar to sp|P40549 Saccharomyces cere... 36 0.43 UniRef50_O14933 Cluster: Ubiquitin/ISG15-conjugating enzyme E2 L... 36 0.43 UniRef50_UPI0000498417 Cluster: ubiquitin-conjugating enzyme; n=... 36 0.56 UniRef50_Q4Q5I6 Cluster: Ubiquitin carrier protein; n=5; Trypano... 36 0.56 UniRef50_A5DNI5 Cluster: Putative uncharacterized protein; n=1; ... 36 0.56 UniRef50_A6RY09 Cluster: Putative uncharacterized protein; n=1; ... 36 0.74 UniRef50_Q9QZU9 Cluster: Ubiquitin/ISG15-conjugating enzyme E2 L... 36 0.74 UniRef50_UPI0000E4A01C Cluster: PREDICTED: similar to ENSANGP000... 35 0.98 UniRef50_UPI0000499A56 Cluster: ubiquitin-conjugating enzyme; n=... 34 1.7 UniRef50_A2AX46 Cluster: Ubiquitin carrier protein; n=2; Eukaryo... 34 1.7 UniRef50_A0CD76 Cluster: Ubiquitin carrier protein; n=4; Paramec... 34 1.7 UniRef50_A0C867 Cluster: Ubiquitin carrier protein; n=4; Oligohy... 34 1.7 UniRef50_A0A5E9 Cluster: Ubiquitin-conjugating enzyme,; n=1; Tox... 34 1.7 UniRef50_Q9VGD6 Cluster: CG14739-PA; n=2; Sophophora|Rep: CG1473... 34 2.3 UniRef50_Q0TYP6 Cluster: Putative uncharacterized protein; n=1; ... 34 2.3 UniRef50_A7EC39 Cluster: Putative uncharacterized protein; n=1; ... 33 3.0 UniRef50_A6RGW5 Cluster: Ubiquitin carrier protein; n=1; Ajellom... 33 3.0 UniRef50_UPI000050708E Cluster: PREDICTED: similar to ubiquitin-... 33 4.0 UniRef50_Q8IDP1 Cluster: Ubiquitin-conjugating enzyme, putative;... 33 4.0 UniRef50_Q20617 Cluster: Putative uncharacterized protein ubc-24... 33 4.0 UniRef50_Q2U429 Cluster: Ubiquitin carrier protein; n=7; Pezizom... 33 4.0 UniRef50_A2DSA6 Cluster: Ubiquitin carrier protein; n=1; Trichom... 33 5.2 UniRef50_A0DRM5 Cluster: Chromosome undetermined scaffold_60, wh... 33 5.2 UniRef50_A2QMZ8 Cluster: Ubiquitin carrier protein; n=7; Pezizom... 33 5.2 UniRef50_Q7Z460 Cluster: CLIP-associating protein 1; n=26; Eutel... 33 5.2 UniRef50_Q4QC44 Cluster: Putative uncharacterized protein; n=2; ... 32 6.9 UniRef50_Q8SS54 Cluster: Ubiquitin carrier protein; n=1; Encepha... 32 6.9 UniRef50_Q4P877 Cluster: Ubiquitin carrier protein; n=1; Ustilag... 32 6.9 UniRef50_UPI00004984D9 Cluster: Ran-binding protein; n=1; Entamo... 32 9.2 UniRef50_A7RTQ5 Cluster: Predicted protein; n=1; Nematostella ve... 32 9.2 UniRef50_A2EL66 Cluster: Surface antigen BspA-like; n=1; Trichom... 32 9.2 UniRef50_P29340 Cluster: Ubiquitin-conjugating enzyme E2-21 kDa;... 32 9.2 >UniRef50_UPI0000F2B380 Cluster: PREDICTED: similar to Chain B, Crystal Structure Of Human Ubiquitin-Conjugating Enzyme Ubch5b; n=2; Amniota|Rep: PREDICTED: similar to Chain B, Crystal Structure Of Human Ubiquitin-Conjugating Enzyme Ubch5b - Monodelphis domestica Length = 270 Score = 139 bits (337), Expect = 3e-32 Identities = 62/66 (93%), Positives = 65/66 (98%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELAREW 180 GSICLDILR+QWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYN +AREW Sbjct: 205 GSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNRIAREW 264 Query: 181 TRKYAM 198 T+KYAM Sbjct: 265 TQKYAM 270 >UniRef50_P62837 Cluster: Ubiquitin-conjugating enzyme E2 D2 (EC 6.3.2.19) (Ubiquitin-protein ligase D2) (Ubiquitin carrier protein D2) (Ubiquitin-conjugating enzyme E2-17 kDa 2) (E2(17)KB 2); n=169; Eukaryota|Rep: Ubiquitin-conjugating enzyme E2 D2 (EC 6.3.2.19) (Ubiquitin-protein ligase D2) (Ubiquitin carrier protein D2) (Ubiquitin-conjugating enzyme E2-17 kDa 2) (E2(17)KB 2) - Homo sapiens (Human) Length = 147 Score = 139 bits (337), Expect = 3e-32 Identities = 62/66 (93%), Positives = 65/66 (98%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELAREW 180 GSICLDILR+QWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYN +AREW Sbjct: 82 GSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNRIAREW 141 Query: 181 TRKYAM 198 T+KYAM Sbjct: 142 TQKYAM 147 >UniRef50_Q7SXH5 Cluster: Ubiquitin carrier protein; n=9; Eukaryota|Rep: Ubiquitin carrier protein - Danio rerio (Zebrafish) (Brachydanio rerio) Length = 147 Score = 132 bits (320), Expect = 4e-30 Identities = 57/66 (86%), Positives = 64/66 (96%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELAREW 180 GSICLDILR+QWSPALT+SKVLLSICSLLCDPNPDDPLVP+IA IYK+D++KYN LAREW Sbjct: 82 GSICLDILRSQWSPALTVSKVLLSICSLLCDPNPDDPLVPDIAHIYKSDKDKYNRLAREW 141 Query: 181 TRKYAM 198 T+KYAM Sbjct: 142 TQKYAM 147 >UniRef50_A6NLF6 Cluster: Ubiquitin carrier protein; n=4; Eutheria|Rep: Ubiquitin carrier protein - Homo sapiens (Human) Length = 146 Score = 131 bits (317), Expect = 8e-30 Identities = 57/66 (86%), Positives = 64/66 (96%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELAREW 180 GSICLDILR+QWSPALT+SKVLLSICSLLCDPNPDDPLVP+IA+IYK+D+EKYN AREW Sbjct: 81 GSICLDILRSQWSPALTVSKVLLSICSLLCDPNPDDPLVPDIAQIYKSDKEKYNRHAREW 140 Query: 181 TRKYAM 198 T+KYAM Sbjct: 141 TQKYAM 146 >UniRef50_P35132 Cluster: SUMO-conjugating enzyme UBC9; n=75; Eukaryota|Rep: SUMO-conjugating enzyme UBC9 - Arabidopsis thaliana (Mouse-ear cress) Length = 148 Score = 121 bits (291), Expect = 1e-26 Identities = 54/66 (81%), Positives = 58/66 (87%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELAREW 180 GSICLDIL+ QWSPALTISKVLLSICSLL DPNPDDPLVPEIA +YKTD+ KY AR W Sbjct: 82 GSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDKNKYESTARTW 141 Query: 181 TRKYAM 198 T+KYAM Sbjct: 142 TQKYAM 147 >UniRef50_A2YZH4 Cluster: Ubiquitin carrier protein; n=3; Spermatophyta|Rep: Ubiquitin carrier protein - Oryza sativa subsp. indica (Rice) Length = 284 Score = 115 bits (277), Expect = 6e-25 Identities = 52/66 (78%), Positives = 57/66 (86%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELAREW 180 GSICLDIL+ QWSPALTISKVLLSI SLL DPNPDDPLVPEIA +YK+ R +Y E AR W Sbjct: 82 GSICLDILKEQWSPALTISKVLLSISSLLTDPNPDDPLVPEIAHVYKSQRPRYEETARAW 141 Query: 181 TRKYAM 198 T+KYAM Sbjct: 142 TQKYAM 147 >UniRef50_UPI000066142F Cluster: Homolog of Brachydanio rerio "Ubiquitin-conjugating enzyme E2D 2.; n=1; Takifugu rubripes|Rep: Homolog of Brachydanio rerio "Ubiquitin-conjugating enzyme E2D 2. - Takifugu rubripes Length = 156 Score = 89.0 bits (211), Expect(2) = 5e-24 Identities = 38/46 (82%), Positives = 43/46 (93%) Frame = +1 Query: 61 VLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELAREWTRKYAM 198 VLLSICSLLCDPNPDDPLVPEIARIYKTD +YN+ A++WT+KYAM Sbjct: 111 VLLSICSLLCDPNPDDPLVPEIARIYKTDLVRYNKTAQDWTQKYAM 156 Score = 44.4 bits (100), Expect(2) = 5e-24 Identities = 19/20 (95%), Positives = 20/20 (100%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISK 60 GSICLDILR+QWSPALTISK Sbjct: 53 GSICLDILRSQWSPALTISK 72 >UniRef50_Q96LR5 Cluster: Ubiquitin-conjugating enzyme E2 E2; n=112; Eukaryota|Rep: Ubiquitin-conjugating enzyme E2 E2 - Homo sapiens (Human) Length = 201 Score = 94.3 bits (224), Expect = 2e-18 Identities = 43/65 (66%), Positives = 52/65 (80%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELAREW 180 G ICLDIL+ WSPALTISKVLLSICSLL D NP DPLV IA Y T+R +++ +AR+W Sbjct: 136 GVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYMTNRAEHDRMARQW 195 Query: 181 TRKYA 195 T++YA Sbjct: 196 TKRYA 200 >UniRef50_Q5KIQ6 Cluster: Ubiquitin carrier protein; n=1; Filobasidiella neoformans|Rep: Ubiquitin carrier protein - Cryptococcus neoformans (Filobasidiella neoformans) Length = 260 Score = 92.3 bits (219), Expect = 6e-18 Identities = 39/66 (59%), Positives = 52/66 (78%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELAREW 180 G+ICLD+L+ WSPAL++ KV+LS+ SLL DPNP DPLVP IA Y+ +R K++ AREW Sbjct: 92 GAICLDLLKTAWSPALSLYKVILSLSSLLTDPNPADPLVPPIASEYRNNRRKHDATAREW 151 Query: 181 TRKYAM 198 RK+A+ Sbjct: 152 VRKFAL 157 >UniRef50_UPI00015B555D Cluster: PREDICTED: similar to ubiquitin-conjugating enzyme UbcD2; n=3; Coelomata|Rep: PREDICTED: similar to ubiquitin-conjugating enzyme UbcD2 - Nasonia vitripennis Length = 176 Score = 91.9 bits (218), Expect = 8e-18 Identities = 43/65 (66%), Positives = 51/65 (78%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELAREW 180 G ICLDIL+ WSPALTISKVLLSICSLL D NP DPLV IA Y +RE+++ +AR W Sbjct: 111 GVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYLQNREEHDRIARLW 170 Query: 181 TRKYA 195 T++YA Sbjct: 171 TKRYA 175 >UniRef50_Q9I7T6 Cluster: Ubiquitin carrier protein; n=5; Eukaryota|Rep: Ubiquitin carrier protein - Drosophila melanogaster (Fruit fly) Length = 354 Score = 88.6 bits (210), Expect = 8e-17 Identities = 38/65 (58%), Positives = 52/65 (80%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELAREW 180 G ICLDIL ++WSPAL++SKVL+SI SLL DPNP DP+ +A ++K +R +++ AREW Sbjct: 289 GRICLDILGSKWSPALSVSKVLISIMSLLADPNPHDPMEVSVADVFKGNRALHDKNAREW 348 Query: 181 TRKYA 195 T+KYA Sbjct: 349 TKKYA 353 >UniRef50_Q0DBY7 Cluster: Os06g0506600 protein; n=1; Oryza sativa (japonica cultivar-group)|Rep: Os06g0506600 protein - Oryza sativa subsp. japonica (Rice) Length = 84 Score = 85.4 bits (202), Expect = 7e-16 Identities = 38/47 (80%), Positives = 40/47 (85%) Frame = +1 Query: 58 KVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELAREWTRKYAM 198 KVLLSICSLL DPNPDDPLVPEIA +YKTDR KY AR WT+KYAM Sbjct: 37 KVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYESTARGWTQKYAM 83 >UniRef50_Q9C8X7 Cluster: Putative ubiquitin conjugating enzyme; 36006-34873; n=1; Arabidopsis thaliana|Rep: Putative ubiquitin conjugating enzyme; 36006-34873 - Arabidopsis thaliana (Mouse-ear cress) Length = 154 Score = 83.8 bits (198), Expect = 2e-15 Identities = 36/65 (55%), Positives = 53/65 (81%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELAREW 180 GSIC++IL+ +W+PAL + KVLLSI LL PNPDDPLVPEI +++K +R ++++ ARE+ Sbjct: 88 GSICMNILKDKWTPALMVEKVLLSILLLLEKPNPDDPLVPEIGQLFKNNRFQFDQRAREF 147 Query: 181 TRKYA 195 T ++A Sbjct: 148 TARHA 152 >UniRef50_A0C0C6 Cluster: Chromosome undetermined scaffold_14, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_14, whole genome shotgun sequence - Paramecium tetraurelia Length = 150 Score = 83.4 bits (197), Expect = 3e-15 Identities = 36/65 (55%), Positives = 48/65 (73%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELAREW 180 G ICL+IL WSP LTI K+LLSI +LL DPNP+ PL+ ++ I+K D+ Y + A+EW Sbjct: 85 GQICLEILGQNWSPNLTIRKLLLSILALLYDPNPNSPLLEDVNTIFKNDKAAYLQKAKEW 144 Query: 181 TRKYA 195 T+KYA Sbjct: 145 TKKYA 149 >UniRef50_Q8SQR1 Cluster: Ubiquitin carrier protein; n=1; Encephalitozoon cuniculi|Rep: Ubiquitin carrier protein - Encephalitozoon cuniculi Length = 175 Score = 82.2 bits (194), Expect = 7e-15 Identities = 37/63 (58%), Positives = 48/63 (76%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELAREW 180 G IC+DIL +WSPALT++ VLLS+ +LL DPN DDPL PE+A IYKT++E+Y +E Sbjct: 107 GMICIDILGKEWSPALTLNSVLLSLLTLLDDPNADDPLRPEVADIYKTNKEEYRLRCQES 166 Query: 181 TRK 189 RK Sbjct: 167 ARK 169 >UniRef50_P61088 Cluster: Ubiquitin-conjugating enzyme E2 N; n=123; Eukaryota|Rep: Ubiquitin-conjugating enzyme E2 N - Homo sapiens (Human) Length = 152 Score = 81.8 bits (193), Expect = 9e-15 Identities = 39/66 (59%), Positives = 47/66 (71%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELAREW 180 G ICLDIL+ +WSPAL I VLLSI +LL PNPDDPL ++A +KT+ + E AR W Sbjct: 84 GRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAEQWKTNEAQAIETARAW 143 Query: 181 TRKYAM 198 TR YAM Sbjct: 144 TRLYAM 149 >UniRef50_Q9VYN3 Cluster: Ubiquitin carrier protein; n=2; Sophophora|Rep: Ubiquitin carrier protein - Drosophila melanogaster (Fruit fly) Length = 239 Score = 81.4 bits (192), Expect = 1e-14 Identities = 35/66 (53%), Positives = 51/66 (77%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELAREW 180 G+ICLD+L +WSP + ++KVLLSI L+ + NPDDPLV IA YKT+R +++++AR W Sbjct: 143 GAICLDVLGERWSPVMNVAKVLLSIYVLMSECNPDDPLVMCIADQYKTNRREHDKIARHW 202 Query: 181 TRKYAM 198 T+ +AM Sbjct: 203 TKLFAM 208 >UniRef50_Q54IK3 Cluster: Ubiquitin carrier protein; n=1; Dictyostelium discoideum AX4|Rep: Ubiquitin carrier protein - Dictyostelium discoideum AX4 Length = 585 Score = 80.6 bits (190), Expect = 2e-14 Identities = 37/65 (56%), Positives = 44/65 (67%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELAREW 180 G+ICLDIL+ WSPALTISKV+LSI LL PNP DPL A +Y+ D YN+ EW Sbjct: 507 GNICLDILKDSWSPALTISKVMLSISQLLVTPNPHDPLDVVKAGVYRDDVNNYNKNCEEW 566 Query: 181 TRKYA 195 +YA Sbjct: 567 CERYA 571 >UniRef50_P35128 Cluster: Ubiquitin-conjugating enzyme E2-17 kDa; n=30; Eukaryota|Rep: Ubiquitin-conjugating enzyme E2-17 kDa - Drosophila melanogaster (Fruit fly) Length = 151 Score = 80.2 bits (189), Expect = 3e-14 Identities = 35/66 (53%), Positives = 48/66 (72%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELAREW 180 G ICLD+L+ +WSPAL I +LLSI +LL PNPDDPL ++A ++K + + AREW Sbjct: 84 GRICLDVLKDKWSPALQIRTILLSIQALLSAPNPDDPLANDVAELWKVNEAEAIRNAREW 143 Query: 181 TRKYAM 198 T+KYA+ Sbjct: 144 TQKYAV 149 >UniRef50_Q9LJD7 Cluster: Constitutive photomorphogenesis protein 10; n=41; Eukaryota|Rep: Constitutive photomorphogenesis protein 10 - Arabidopsis thaliana (Mouse-ear cress) Length = 182 Score = 80.2 bits (189), Expect = 3e-14 Identities = 35/65 (53%), Positives = 49/65 (75%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELAREW 180 G + ++ILR WSPALTI+KVL +I S+ P P P +P IAR+Y TDREK++E+A+EW Sbjct: 117 GDLSVNILRDSWSPALTITKVLQAIRSIFLKPEPYSPALPVIARLYLTDREKHDEVAKEW 176 Query: 181 TRKYA 195 T ++A Sbjct: 177 TLRFA 181 >UniRef50_Q54P16 Cluster: Ubiquitin conjugating enzyme; n=2; Dictyostelium discoideum|Rep: Ubiquitin conjugating enzyme - Dictyostelium discoideum AX4 Length = 148 Score = 78.6 bits (185), Expect = 8e-14 Identities = 35/65 (53%), Positives = 48/65 (73%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELAREW 180 G+IC ++ + WSP L I VL +I S+L DPNPD+PL EIA+ +KTDR +N+ A+EW Sbjct: 84 GAICAEVF-STWSPQLKILDVLTTIRSILTDPNPDNPLETEIAQQFKTDRNAFNKTAKEW 142 Query: 181 TRKYA 195 T+KYA Sbjct: 143 TKKYA 147 >UniRef50_Q4PH88 Cluster: Ubiquitin carrier protein; n=3; Dikarya|Rep: Ubiquitin carrier protein - Ustilago maydis (Smut fungus) Length = 227 Score = 78.2 bits (184), Expect = 1e-13 Identities = 33/65 (50%), Positives = 44/65 (67%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELAREW 180 G+ICLDIL+ QWSP LT+ L+S+ SLLC P P+DP E+A+ Y D+ + + AR W Sbjct: 86 GAICLDILKDQWSPVLTLKSTLMSLRSLLCSPEPNDPQDAEVAKHYLRDKNDFEKTARYW 145 Query: 181 TRKYA 195 T YA Sbjct: 146 TEIYA 150 >UniRef50_Q5CQL8 Cluster: Ubiquitin carrier protein; n=2; Cryptosporidium|Rep: Ubiquitin carrier protein - Cryptosporidium parvum Iowa II Length = 197 Score = 77.8 bits (183), Expect = 1e-13 Identities = 34/65 (52%), Positives = 47/65 (72%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELAREW 180 G+ICLDIL+ WSPALT+ V+LSI +LL P P+DP +A +YK+D ++Y E A+ W Sbjct: 89 GAICLDILKDAWSPALTLRTVMLSIQALLSSPEPNDPQDALVASLYKSDYQEYIETAKSW 148 Query: 181 TRKYA 195 T+ YA Sbjct: 149 TQMYA 153 >UniRef50_A0E347 Cluster: Ubiquitin carrier protein; n=4; Eukaryota|Rep: Ubiquitin carrier protein - Paramecium tetraurelia Length = 197 Score = 77.4 bits (182), Expect = 2e-13 Identities = 33/65 (50%), Positives = 46/65 (70%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELAREW 180 G+ICLDIL+ QWSPAL+I LLS+ +L CDP PD P +A YK++++ + + A+EW Sbjct: 90 GAICLDILKDQWSPALSIRTALLSLQALFCDPQPDSPQDAVVANQYKSNKDLFVKTAKEW 149 Query: 181 TRKYA 195 T YA Sbjct: 150 TLNYA 154 >UniRef50_A2F262 Cluster: Ubiquitin carrier protein; n=3; Eukaryota|Rep: Ubiquitin carrier protein - Trichomonas vaginalis G3 Length = 150 Score = 76.2 bits (179), Expect = 4e-13 Identities = 33/65 (50%), Positives = 45/65 (69%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELAREW 180 G ICLDIL+ +W+P + I +LSI SL+C+P +DPL +I + Y TDR+ E AREW Sbjct: 83 GRICLDILKTEWTPVMNIETTVLSIQSLMCEPCLEDPLETQICQHYVTDRKGAEETAREW 142 Query: 181 TRKYA 195 T+ YA Sbjct: 143 TKLYA 147 >UniRef50_Q0IF72 Cluster: Ubiquitin-conjugating enzyme morgue; n=2; Culicidae|Rep: Ubiquitin-conjugating enzyme morgue - Aedes aegypti (Yellowfever mosquito) Length = 392 Score = 74.9 bits (176), Expect = 1e-12 Identities = 35/66 (53%), Positives = 46/66 (69%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELAREW 180 G + +DI++ WS ALTISK+LLS+ SLL DP + PE+ R+Y+ DR K+ LAR W Sbjct: 316 GDVGIDIIQHNWSLALTISKLLLSVQSLLTDPFTQICMEPELGRMYENDRPKFEALARRW 375 Query: 181 TRKYAM 198 T KYAM Sbjct: 376 TWKYAM 381 >UniRef50_A0E1Q4 Cluster: Ubiquitin carrier protein; n=6; Eukaryota|Rep: Ubiquitin carrier protein - Paramecium tetraurelia Length = 720 Score = 74.1 bits (174), Expect = 2e-12 Identities = 32/63 (50%), Positives = 42/63 (66%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELAREW 180 G ICLDIL+ QW+P L + +L SI SLLCDPNP+ P PE A++Y +DR +Y +E Sbjct: 649 GRICLDILKEQWTPILDVWAILTSIRSLLCDPNPNSPANPEAAKLYMSDRAEYYRRVKEQ 708 Query: 181 TRK 189 K Sbjct: 709 VEK 711 >UniRef50_P21734 Cluster: Ubiquitin-conjugating enzyme E2-24 kDa; n=13; Ascomycota|Rep: Ubiquitin-conjugating enzyme E2-24 kDa - Saccharomyces cerevisiae (Baker's yeast) Length = 215 Score = 74.1 bits (174), Expect = 2e-12 Identities = 32/65 (49%), Positives = 44/65 (67%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELAREW 180 G+ICLDIL+ WSP +T+ L+S+ +LL P P+DP E+A+ Y DRE +N+ A W Sbjct: 85 GAICLDILKNAWSPVITLKSALISLQALLQSPEPNDPQDAEVAQHYLRDRESFNKTAALW 144 Query: 181 TRKYA 195 TR YA Sbjct: 145 TRLYA 149 >UniRef50_Q0JLE6 Cluster: Ubiquitin carrier protein; n=4; Magnoliophyta|Rep: Ubiquitin carrier protein - Oryza sativa subsp. japonica (Rice) Length = 556 Score = 72.9 bits (171), Expect = 4e-12 Identities = 37/69 (53%), Positives = 46/69 (66%), Gaps = 4/69 (5%) Frame = +1 Query: 1 GSICLDIL----RAQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNEL 168 G ICLDIL + W P+L I+ VL SI LL DPNPDD L+ EI+R YK +R+ ++ Sbjct: 92 GRICLDILNLPPKGAWQPSLNIATVLTSIGLLLSDPNPDDGLMAEISREYKYNRQVFDIN 151 Query: 169 AREWTRKYA 195 AR WT KYA Sbjct: 152 ARSWTEKYA 160 >UniRef50_A2YII6 Cluster: Ubiquitin carrier protein; n=5; Eukaryota|Rep: Ubiquitin carrier protein - Oryza sativa subsp. indica (Rice) Length = 176 Score = 72.5 bits (170), Expect = 5e-12 Identities = 31/59 (52%), Positives = 41/59 (69%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELARE 177 GSICLDIL+ QWSP ++ +L SI SLLCDPNP+ P E AR++ ++ +YN RE Sbjct: 109 GSICLDILQNQWSPIYDVAAILTSIQSLLCDPNPNSPANSEAARLFSENKREYNRKVRE 167 >UniRef50_A7RL90 Cluster: Predicted protein; n=2; Nematostella vectensis|Rep: Predicted protein - Nematostella vectensis Length = 209 Score = 72.5 bits (170), Expect = 5e-12 Identities = 34/70 (48%), Positives = 47/70 (67%), Gaps = 4/70 (5%) Frame = +1 Query: 1 GSICLDILR----AQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNEL 168 G ICLD L+ W PAL IS VL +I L+ +PNPDDPL+ EI+ +K ++ ++ E Sbjct: 84 GRICLDTLKMPPKGMWKPALNISSVLSTILILMAEPNPDDPLMAEISNEFKYNKAQFLEK 143 Query: 169 AREWTRKYAM 198 A+EWT K+AM Sbjct: 144 AKEWTLKFAM 153 >UniRef50_UPI0000519DF4 Cluster: PREDICTED: similar to modifier of rpr and grim, ubiquitously expressed CG15437-PA, partial; n=1; Apis mellifera|Rep: PREDICTED: similar to modifier of rpr and grim, ubiquitously expressed CG15437-PA, partial - Apis mellifera Length = 481 Score = 72.1 bits (169), Expect = 7e-12 Identities = 33/66 (50%), Positives = 45/66 (68%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELAREW 180 G + +D + WS ALTISKVL+S+ SLL DP + PE+ +Y DREK++E+AR W Sbjct: 409 GDVGIDSIHHNWSLALTISKVLISVQSLLTDPYCQVCMEPELGEMYMNDREKFDEIARAW 468 Query: 181 TRKYAM 198 T +YAM Sbjct: 469 TWRYAM 474 >UniRef50_Q00WD5 Cluster: Chromosome 14 contig 1, DNA sequence; n=1; Ostreococcus tauri|Rep: Chromosome 14 contig 1, DNA sequence - Ostreococcus tauri Length = 250 Score = 71.7 bits (168), Expect = 9e-12 Identities = 38/73 (52%), Positives = 55/73 (75%) Frame = -1 Query: 221 LMSQLTHHMAYFLVHSRANSLYFSLSVL*ILAISGTKGSSGLGSHRSEQIESNTLDMVSA 42 ++SQ+ +++AY VHS A+SLY SVL AISGTKGSSG GS EQ+ +TL +V+A Sbjct: 1 MLSQV-YNVAYLRVHSFASSLYRLRSVLYTCAISGTKGSSGFGSVSREQMLRSTLLIVNA 59 Query: 41 GDHCARRMSRQME 3 GDHC+ ++S+Q++ Sbjct: 60 GDHCSFKISKQID 72 >UniRef50_Q54J12 Cluster: Ubiquitin carrier protein; n=1; Dictyostelium discoideum AX4|Rep: Ubiquitin carrier protein - Dictyostelium discoideum AX4 Length = 549 Score = 71.3 bits (167), Expect = 1e-11 Identities = 34/65 (52%), Positives = 44/65 (67%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELAREW 180 G+ICLDIL+ WS A+T KVLLSI SLL +PNP DPL A IY+ + +YN ++W Sbjct: 472 GNICLDILKDHWSAAITTEKVLLSIHSLLSNPNPMDPLDVVKAGIYRDNITEYNAQCKKW 531 Query: 181 TRKYA 195 + YA Sbjct: 532 VQDYA 536 >UniRef50_A7Q2F7 Cluster: Chromosome chr1 scaffold_46, whole genome shotgun sequence; n=1; Vitis vinifera|Rep: Chromosome chr1 scaffold_46, whole genome shotgun sequence - Vitis vinifera (Grape) Length = 94 Score = 70.5 bits (165), Expect = 2e-11 Identities = 33/49 (67%), Positives = 37/49 (75%) Frame = +1 Query: 22 LRAQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNEL 168 L+ +W PALTI KVLLSICSLL D NP+DPLVPEIA IYKT +L Sbjct: 8 LKERWCPALTIIKVLLSICSLLMDSNPNDPLVPEIAHIYKTIEASMRQL 56 >UniRef50_Q9LQI1 Cluster: F15O4.3; n=1; Arabidopsis thaliana|Rep: F15O4.3 - Arabidopsis thaliana (Mouse-ear cress) Length = 123 Score = 70.1 bits (164), Expect = 3e-11 Identities = 32/60 (53%), Positives = 46/60 (76%), Gaps = 6/60 (10%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISK------VLLSICSLLCDPNPDDPLVPEIARIYKTDREKYN 162 GSIC+DIL+ +W+P+LT+ K VLLSI LL DPNP+DPLVPEI +++K +R +++ Sbjct: 64 GSICIDILKDKWTPSLTVEKLINKSHVLLSITVLLADPNPNDPLVPEIGQLFKNNRFQFD 123 >UniRef50_Q8LC61 Cluster: E2, ubiquitin-conjugating enzyme, putative; n=2; Arabidopsis thaliana|Rep: E2, ubiquitin-conjugating enzyme, putative - Arabidopsis thaliana (Mouse-ear cress) Length = 177 Score = 69.3 bits (162), Expect = 5e-11 Identities = 36/67 (53%), Positives = 48/67 (71%), Gaps = 2/67 (2%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVLLSICSLLCDPNPDDPLV--PEIARIYKTDREKYNELAR 174 G +DIL ++WS ALTI+ VLLSICS+L NP +PL+ AR+Y+ DR+ Y ++AR Sbjct: 111 GESFVDILGSRWSSALTINLVLLSICSIL--SNPVEPLLVSNHAARLYQKDRKAYEKVAR 168 Query: 175 EWTRKYA 195 EWT KYA Sbjct: 169 EWTLKYA 175 >UniRef50_A2WYK3 Cluster: Ubiquitin carrier protein; n=2; Oryza sativa|Rep: Ubiquitin carrier protein - Oryza sativa subsp. indica (Rice) Length = 195 Score = 69.3 bits (162), Expect = 5e-11 Identities = 32/65 (49%), Positives = 42/65 (64%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELAREW 180 G+ICLDIL+ QWSPALT+ LLS+ +LL P PDDP +A+ Y D ++ AR W Sbjct: 86 GAICLDILKDQWSPALTLKTALLSLQALLSAPAPDDPQDAVVAQQYLRDYSTFSATARYW 145 Query: 181 TRKYA 195 T +A Sbjct: 146 TEAFA 150 >UniRef50_A0CH05 Cluster: Chromosome undetermined scaffold_18, whole genome shotgun sequence; n=3; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_18, whole genome shotgun sequence - Paramecium tetraurelia Length = 562 Score = 69.3 bits (162), Expect = 5e-11 Identities = 32/65 (49%), Positives = 44/65 (67%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELAREW 180 G++CLD+L+ QWSPAL++ VLLSI SLL DPNPDD L +A YK ++ Y + + Sbjct: 461 GAVCLDVLKDQWSPALSVFSVLLSIRSLLIDPNPDDALDSNVAAEYKHEKALYTQNVIKE 520 Query: 181 TRKYA 195 + YA Sbjct: 521 KQLYA 525 >UniRef50_UPI00015B43E7 Cluster: PREDICTED: similar to ubiquitin-conjugating enzyme morgue; n=1; Nasonia vitripennis|Rep: PREDICTED: similar to ubiquitin-conjugating enzyme morgue - Nasonia vitripennis Length = 522 Score = 68.9 bits (161), Expect = 7e-11 Identities = 32/66 (48%), Positives = 43/66 (65%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELAREW 180 G + +D + WS ALTISKVL+S+ SLL DP + PE+ +Y DR ++ E+AR W Sbjct: 450 GDVGIDSIHHNWSLALTISKVLISVQSLLTDPYCQVCMEPELGEMYMNDRARFEEVARAW 509 Query: 181 TRKYAM 198 T KYAM Sbjct: 510 TWKYAM 515 >UniRef50_Q43780 Cluster: Ubiquitin carrier protein; n=15; Eukaryota|Rep: Ubiquitin carrier protein - Solanum lycopersicum (Tomato) (Lycopersicon esculentum) Length = 194 Score = 68.9 bits (161), Expect = 7e-11 Identities = 32/65 (49%), Positives = 42/65 (64%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELAREW 180 G+ICLDIL+ QWSPALT+ LLSI +LL P PDDP +A+ Y + + + AR W Sbjct: 85 GAICLDILKDQWSPALTLKTALLSIQALLSAPEPDDPQDAVVAQQYLREHQTFVGTARYW 144 Query: 181 TRKYA 195 T +A Sbjct: 145 TETFA 149 >UniRef50_Q9LV54 Cluster: Ubiquitin carrier protein; n=2; Arabidopsis thaliana|Rep: Ubiquitin carrier protein - Arabidopsis thaliana (Mouse-ear cress) Length = 409 Score = 68.5 bits (160), Expect = 9e-11 Identities = 35/69 (50%), Positives = 46/69 (66%), Gaps = 4/69 (5%) Frame = +1 Query: 1 GSICLDIL----RAQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNEL 168 G ICLDIL + W P+L IS VL S+ LL +PNPDD L+ E++R YK +R+ ++ Sbjct: 96 GRICLDILNLPPKGAWQPSLNISTVLTSMRLLLSEPNPDDGLMCEVSREYKYNRQTFDYK 155 Query: 169 AREWTRKYA 195 ARE T KYA Sbjct: 156 AREMTEKYA 164 >UniRef50_UPI0000ECA0A1 Cluster: Ubiquitin-conjugating enzyme E2 T (EC 6.3.2.19) (Ubiquitin-protein ligase T) (Ubiquitin carrier protein T).; n=3; Amniota|Rep: Ubiquitin-conjugating enzyme E2 T (EC 6.3.2.19) (Ubiquitin-protein ligase T) (Ubiquitin carrier protein T). - Gallus gallus Length = 158 Score = 67.7 bits (158), Expect = 2e-10 Identities = 32/69 (46%), Positives = 46/69 (66%), Gaps = 4/69 (5%) Frame = +1 Query: 1 GSICLDILR----AQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNEL 168 G ICLD+L+ W P+L IS +L SI L+ +PNPDDPL+ +I+ YK +++ + Sbjct: 47 GRICLDVLKLPPKGAWRPSLNISTLLTSIQLLMVEPNPDDPLMADISSEYKYNKQLFLIN 106 Query: 169 AREWTRKYA 195 A+EWT KYA Sbjct: 107 AKEWTEKYA 115 >UniRef50_Q9Y165 Cluster: CG15437-PA; n=4; Sophophora|Rep: CG15437-PA - Drosophila melanogaster (Fruit fly) Length = 491 Score = 65.3 bits (152), Expect = 8e-10 Identities = 31/67 (46%), Positives = 45/67 (67%), Gaps = 1/67 (1%) Frame = +1 Query: 1 GSICLDILRAQ-WSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELARE 177 G + +DI + WS AL ++KVLLS+ SLL DP + + PE+ IY+ +RE++ +L R Sbjct: 418 GDVGIDIFQQHNWSLALNVAKVLLSVQSLLTDPYTEVCMEPELGYIYEHERERFEQLVRA 477 Query: 178 WTRKYAM 198 WT KYAM Sbjct: 478 WTWKYAM 484 >UniRef50_P61086 Cluster: Ubiquitin-conjugating enzyme E2-25 kDa (EC 6.3.2.19) (Ubiquitin- protein ligase) (Ubiquitin carrier protein) (E2(25K)); n=43; Eumetazoa|Rep: Ubiquitin-conjugating enzyme E2-25 kDa (EC 6.3.2.19) (Ubiquitin- protein ligase) (Ubiquitin carrier protein) (E2(25K)) - Homo sapiens (Human) Length = 200 Score = 65.3 bits (152), Expect = 8e-10 Identities = 30/65 (46%), Positives = 41/65 (63%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELAREW 180 G+ICLDIL+ QW+ A+T+ VLLS+ +LL PDDP +A YK + E + + AR W Sbjct: 89 GAICLDILKDQWAAAMTLRTVLLSLQALLAAAEPDDPQDAVVANQYKQNPEMFKQTARLW 148 Query: 181 TRKYA 195 YA Sbjct: 149 AHVYA 153 >UniRef50_Q7QT23 Cluster: Ubiquitin carrier protein; n=1; Giardia lamblia ATCC 50803|Rep: Ubiquitin carrier protein - Giardia lamblia ATCC 50803 Length = 196 Score = 64.9 bits (151), Expect = 1e-09 Identities = 29/54 (53%), Positives = 37/54 (68%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYN 162 G+ICLD+L +W+PAL +S +LLSI SLL DPNP P E A ++ DR YN Sbjct: 90 GNICLDLLSTKWTPALGVSAILLSIQSLLTDPNPMSPANNEAAALFVNDRHTYN 143 >UniRef50_A2EY78 Cluster: Ubiquitin carrier protein; n=1; Trichomonas vaginalis G3|Rep: Ubiquitin carrier protein - Trichomonas vaginalis G3 Length = 144 Score = 64.9 bits (151), Expect = 1e-09 Identities = 29/65 (44%), Positives = 39/65 (60%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELAREW 180 G ICLD L+ +W P T+ + I LL +PN D PL+P+I Y D + + + AREW Sbjct: 79 GQICLDQLKNEWKPTYTLKHAIEFIIFLLQNPNWDSPLMPQIGAEYAQDPKLFEQKAREW 138 Query: 181 TRKYA 195 T KYA Sbjct: 139 TAKYA 143 >UniRef50_Q9NPD8 Cluster: Ubiquitin-conjugating enzyme E2 T; n=16; Coelomata|Rep: Ubiquitin-conjugating enzyme E2 T - Homo sapiens (Human) Length = 197 Score = 64.9 bits (151), Expect = 1e-09 Identities = 30/69 (43%), Positives = 46/69 (66%), Gaps = 4/69 (5%) Frame = +1 Query: 1 GSICLDILR----AQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNEL 168 G ICLD+L+ W P+L I+ VL SI L+ +PNPDDPL+ +I+ +K ++ + + Sbjct: 83 GRICLDVLKLPPKGAWRPSLNIATVLTSIQLLMSEPNPDDPLMADISSEFKYNKPAFLKN 142 Query: 169 AREWTRKYA 195 AR+WT K+A Sbjct: 143 ARQWTEKHA 151 >UniRef50_A3AAT7 Cluster: Putative uncharacterized protein; n=4; Oryza sativa|Rep: Putative uncharacterized protein - Oryza sativa subsp. japonica (Rice) Length = 416 Score = 64.5 bits (150), Expect = 1e-09 Identities = 32/65 (49%), Positives = 42/65 (64%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELAREW 180 G + LDI + WSPALTI+K+LL S+L DP D P IA+ YK + E Y E AR W Sbjct: 286 GRMALDIFQDNWSPALTINKLLLCFVSVLFDPLLDRPTNRCIAKQYKHEYEAYEEKARAW 345 Query: 181 TRKYA 195 T+K++ Sbjct: 346 TQKHS 350 Score = 39.5 bits (88), Expect = 0.046 Identities = 19/41 (46%), Positives = 25/41 (60%) Frame = +1 Query: 64 LLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELAREWTR 186 LL S+L DP D P+ +IA Y+ + E Y + AREWTR Sbjct: 153 LLGFVSILYDPLLDYPINDDIAEQYENEYELYEKEAREWTR 193 >UniRef50_Q54F00 Cluster: Ubiquitin carrier protein; n=3; Eukaryota|Rep: Ubiquitin carrier protein - Dictyostelium discoideum AX4 Length = 292 Score = 64.5 bits (150), Expect = 1e-09 Identities = 30/69 (43%), Positives = 44/69 (63%), Gaps = 4/69 (5%) Frame = +1 Query: 1 GSICLDILR----AQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNEL 168 G ICLDIL+ +W P+L + +L SI L+ +PNP DPL+ +I+ IYK + ++ + Sbjct: 91 GRICLDILKMPPSGEWKPSLNLLTILTSIRLLMSNPNPYDPLMQDISEIYKNNYNQFFKN 150 Query: 169 AREWTRKYA 195 A WT KYA Sbjct: 151 AEHWTTKYA 159 >UniRef50_Q9FI61 Cluster: Ubiquitin carrier protein; n=3; Viridiplantae|Rep: Ubiquitin carrier protein - Arabidopsis thaliana (Mouse-ear cress) Length = 192 Score = 64.1 bits (149), Expect = 2e-09 Identities = 30/65 (46%), Positives = 40/65 (61%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELAREW 180 G+ICLDIL+ QWSPALT+ L+SI +LL P P DP +A Y + + + AR W Sbjct: 85 GAICLDILKDQWSPALTLKTALVSIQALLSAPEPKDPQDAVVAEQYMKNYQVFVSTARYW 144 Query: 181 TRKYA 195 T +A Sbjct: 145 TETFA 149 >UniRef50_Q4YK13 Cluster: Ubiquitin carrier protein; n=2; Alveolata|Rep: Ubiquitin carrier protein - Plasmodium berghei Length = 149 Score = 63.7 bits (148), Expect = 2e-09 Identities = 30/55 (54%), Positives = 38/55 (69%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNE 165 G+ICLDIL+ QWSP I+ +L SI SLL DPN P PE A+I+ TD+ YN+ Sbjct: 74 GNICLDILQNQWSPIYDITSLLTSIQSLLNDPNTASPANPEAAKIFMTDKLLYNK 128 >UniRef50_Q9UTN8 Cluster: Ubiquitin conjugating enzyme Ubc14; n=1; Schizosaccharomyces pombe|Rep: Ubiquitin conjugating enzyme Ubc14 - Schizosaccharomyces pombe (Fission yeast) Length = 155 Score = 63.7 bits (148), Expect = 2e-09 Identities = 28/66 (42%), Positives = 45/66 (68%), Gaps = 1/66 (1%) Frame = +1 Query: 1 GSICLDILRAQ-WSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELARE 177 G++CL IL+ Q + P++ + VL I LL +PNPDDPLV IA Y+ DR ++++AR+ Sbjct: 88 GNVCLAILKQQVFKPSIKLRSVLEQILQLLREPNPDDPLVASIAEQYRNDRPSFDKIARD 147 Query: 178 WTRKYA 195 + ++A Sbjct: 148 YVEQFA 153 >UniRef50_Q4PGW5 Cluster: Ubiquitin carrier protein; n=2; Basidiomycota|Rep: Ubiquitin carrier protein - Ustilago maydis (Smut fungus) Length = 458 Score = 63.3 bits (147), Expect = 3e-09 Identities = 28/64 (43%), Positives = 44/64 (68%), Gaps = 1/64 (1%) Frame = +1 Query: 1 GSICLDILRAQ-WSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELARE 177 G++C+ IL+++ W P+ +LLSI LL +PN DD LV IA +Y DR K+++ A+E Sbjct: 83 GNLCVGILKSEAWKPSTKAVTILLSILQLLDEPNADDALVASIAELYNKDRAKFDKTAQE 142 Query: 178 WTRK 189 +T+K Sbjct: 143 YTKK 146 >UniRef50_A3FPP4 Cluster: Ubiquitin carrier protein; n=1; Cryptosporidium parvum Iowa II|Rep: Ubiquitin carrier protein - Cryptosporidium parvum Iowa II Length = 137 Score = 62.5 bits (145), Expect = 6e-09 Identities = 25/66 (37%), Positives = 44/66 (66%), Gaps = 1/66 (1%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKT-DREKYNELARE 177 G +C+D+++ W+PA T+ V +I S+LCDPNP+ PL + I + D++ +N +AR Sbjct: 68 GEVCIDVIKDNWTPAWTLHAVCRAIISILCDPNPNSPLNCDAGNILRCGDKKGFNNMARM 127 Query: 178 WTRKYA 195 ++ +YA Sbjct: 128 YSLEYA 133 >UniRef50_A2F2A5 Cluster: Ubiquitin carrier protein; n=1; Trichomonas vaginalis G3|Rep: Ubiquitin carrier protein - Trichomonas vaginalis G3 Length = 162 Score = 62.5 bits (145), Expect = 6e-09 Identities = 29/63 (46%), Positives = 40/63 (63%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELAREW 180 G ICLD+L+ +W+PA IS +L SI SL DPNP P E A ++ +R KYNE ++ Sbjct: 88 GKICLDMLQNKWTPAYDISAILNSIRSLFDDPNPASPANGEAAEAFQNNRPKYNEKVQQC 147 Query: 181 TRK 189 R+ Sbjct: 148 VRE 150 >UniRef50_P25153 Cluster: Ubiquitin-conjugating enzyme E2-17 kDa; n=93; Eukaryota|Rep: Ubiquitin-conjugating enzyme E2-17 kDa - Drosophila melanogaster (Fruit fly) Length = 151 Score = 62.5 bits (145), Expect = 6e-09 Identities = 27/55 (49%), Positives = 37/55 (67%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNE 165 G ICLDIL+ +WSP +S +L SI SLL DPNP+ P A++YK +R +Y + Sbjct: 85 GGICLDILQNRWSPTYDVSAILTSIQSLLSDPNPNSPANSTAAQLYKENRREYEK 139 >UniRef50_UPI00006CC0C2 Cluster: Ubiquitin-conjugating enzyme family protein; n=1; Tetrahymena thermophila SB210|Rep: Ubiquitin-conjugating enzyme family protein - Tetrahymena thermophila SB210 Length = 579 Score = 62.1 bits (144), Expect = 7e-09 Identities = 31/65 (47%), Positives = 40/65 (61%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELAREW 180 G +CLDIL+ QWSPALTI K L S SL+ DPNP+D L IA Y D + + + Sbjct: 474 GHMCLDILKDQWSPALTIQKSLNSFLSLMQDPNPNDALDSTIAAQYLDDINIFKQKCLDH 533 Query: 181 TRKYA 195 ++YA Sbjct: 534 IKQYA 538 >UniRef50_Q57XM0 Cluster: Ubiquitin carrier protein; n=1; Trypanosoma brucei|Rep: Ubiquitin carrier protein - Trypanosoma brucei Length = 226 Score = 62.1 bits (144), Expect = 7e-09 Identities = 28/58 (48%), Positives = 36/58 (62%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELAR 174 G ICLD L+ +W P+L++ VLL I SLL DPNP+ E A +Y R+KY E R Sbjct: 145 GDICLDTLKDKWCPSLSVESVLLMIISLLSDPNPNSAANAEAASMYVQSRDKYEERVR 202 >UniRef50_Q4WU34 Cluster: Ubiquitin carrier protein; n=16; Pezizomycotina|Rep: Ubiquitin carrier protein - Aspergillus fumigatus (Sartorya fumigata) Length = 272 Score = 61.7 bits (143), Expect = 1e-08 Identities = 28/60 (46%), Positives = 37/60 (61%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELAREW 180 G+ICLD L + WSP LTI LLS+ SLL P P DP E+A + +++ +AREW Sbjct: 87 GAICLDTLSSAWSPVLTIKSALLSLQSLLSTPEPKDPQDAEVATMLLRRPKEFERVAREW 146 >UniRef50_UPI00005A4DED Cluster: PREDICTED: similar to ubiquitin-conjugating enzyme E2N; n=1; Canis lupus familiaris|Rep: PREDICTED: similar to ubiquitin-conjugating enzyme E2N - Canis familiaris Length = 284 Score = 61.3 bits (142), Expect = 1e-08 Identities = 33/66 (50%), Positives = 41/66 (62%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELAREW 180 G +CLDIL+ +WSP L I VLL I +LL NPDDPL ++ +KT + E AR Sbjct: 172 GRVCLDILKDKWSP-LQIRTVLLWIQALLSALNPDDPLAKDVVEQWKTSEAQAIETARAR 230 Query: 181 TRKYAM 198 TR YAM Sbjct: 231 TRLYAM 236 >UniRef50_Q8SRC0 Cluster: Ubiquitin carrier protein; n=1; Encephalitozoon cuniculi|Rep: Ubiquitin carrier protein - Encephalitozoon cuniculi Length = 171 Score = 61.3 bits (142), Expect = 1e-08 Identities = 29/67 (43%), Positives = 41/67 (61%), Gaps = 1/67 (1%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVL-LSICSLLCDPNPDDPLVPEIARIYKTDREKYNELARE 177 GSICLD+L WSP + ++ + + LL PN DPL E +Y +REKYNE+ R Sbjct: 82 GSICLDVLNQIWSPIYDLLNIVDILLPQLLSYPNAADPLNCEAGSMYLNNREKYNEVVRS 141 Query: 178 WTRKYAM 198 + +KYA+ Sbjct: 142 YVKKYAI 148 >UniRef50_A0BKX8 Cluster: Chromosome undetermined scaffold_113, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_113, whole genome shotgun sequence - Paramecium tetraurelia Length = 155 Score = 60.9 bits (141), Expect = 2e-08 Identities = 26/65 (40%), Positives = 44/65 (67%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELAREW 180 G I L+ L+ +WS ++ + K+LL I SL PNP +PL ++A+ Y+ D +Y E A++W Sbjct: 83 GCIALNTLKKEWSESIGVKKMLLEILSLFQKPNPQNPLNLKLAQQYQEDCSEYYERAQQW 142 Query: 181 TRKYA 195 T+++A Sbjct: 143 TQQFA 147 >UniRef50_Q4RS31 Cluster: Ubiquitin carrier protein; n=1; Tetraodon nigroviridis|Rep: Ubiquitin carrier protein - Tetraodon nigroviridis (Green puffer) Length = 221 Score = 60.5 bits (140), Expect = 2e-08 Identities = 25/55 (45%), Positives = 39/55 (70%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNE 165 GSICLDIL+ +WSP +S +L SI SLL +PNP+ P + A++Y+ ++ +Y + Sbjct: 154 GSICLDILQNRWSPTYDVSSILTSIQSLLDEPNPNSPANSQAAQLYQENKREYEK 208 >UniRef50_Q8WXB3 Cluster: Ubiquitin carrier protein; n=8; Bilateria|Rep: Ubiquitin carrier protein - Homo sapiens (Human) Length = 80 Score = 60.5 bits (140), Expect = 2e-08 Identities = 25/55 (45%), Positives = 39/55 (70%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNE 165 GSICLDIL+ +WSP +S +L SI SLL +PNP+ P + A++Y+ ++ +Y + Sbjct: 26 GSICLDILQNRWSPTYDVSSILTSIQSLLDEPNPNSPANSQAAQLYQENKREYEK 80 >UniRef50_A6NGR2 Cluster: Uncharacterized protein UBE2A (Ubiquitin-conjugating enzyme E2A (RAD6 homolog), isoform CRA_a); n=6; Euteleostomi|Rep: Uncharacterized protein UBE2A (Ubiquitin-conjugating enzyme E2A (RAD6 homolog), isoform CRA_a) - Homo sapiens (Human) Length = 122 Score = 60.5 bits (140), Expect = 2e-08 Identities = 25/55 (45%), Positives = 39/55 (70%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNE 165 GSICLDIL+ +WSP +S +L SI SLL +PNP+ P + A++Y+ ++ +Y + Sbjct: 55 GSICLDILQNRWSPTYDVSSILTSIQSLLDEPNPNSPANSQAAQLYQENKREYEK 109 >UniRef50_P63146 Cluster: Ubiquitin-conjugating enzyme E2 B; n=55; Eukaryota|Rep: Ubiquitin-conjugating enzyme E2 B - Homo sapiens (Human) Length = 152 Score = 60.5 bits (140), Expect = 2e-08 Identities = 25/55 (45%), Positives = 39/55 (70%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNE 165 GSICLDIL+ +WSP +S +L SI SLL +PNP+ P + A++Y+ ++ +Y + Sbjct: 85 GSICLDILQNRWSPTYDVSSILTSIQSLLDEPNPNSPANSQAAQLYQENKREYEK 139 >UniRef50_Q4DVH2 Cluster: Ubiquitin carrier protein; n=2; Trypanosoma cruzi|Rep: Ubiquitin carrier protein - Trypanosoma cruzi Length = 224 Score = 60.1 bits (139), Expect = 3e-08 Identities = 26/58 (44%), Positives = 35/58 (60%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELAR 174 G+ICLD L+ +WSP L + +L+ I SLL DPNP E A +Y ++KY E R Sbjct: 150 GNICLDTLKTEWSPILDVESLLMMIISLLSDPNPSSAANGEAALLYTNAKDKYEERVR 207 >UniRef50_Q2H4J3 Cluster: Putative uncharacterized protein; n=2; Fungi/Metazoa group|Rep: Putative uncharacterized protein - Chaetomium globosum (Soil fungus) Length = 113 Score = 60.1 bits (139), Expect = 3e-08 Identities = 27/55 (49%), Positives = 37/55 (67%) Frame = +1 Query: 34 WSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELAREWTRKYAM 198 WSPAL I +LLSI +LL PNPDDPL ++A+ +K D A+ WT++YA+ Sbjct: 57 WSPALQIRTILLSIQALLGAPNPDDPLAADVAKSWKEDEAGAIATAKAWTQQYAV 111 >UniRef50_A5DB66 Cluster: Ubiquitin carrier protein; n=1; Pichia guilliermondii|Rep: Ubiquitin carrier protein - Pichia guilliermondii (Yeast) (Candida guilliermondii) Length = 439 Score = 59.7 bits (138), Expect = 4e-08 Identities = 31/85 (36%), Positives = 48/85 (56%), Gaps = 1/85 (1%) Frame = +1 Query: 1 GSICLDILRAQ-WSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELARE 177 G ICLDIL+++ WSPA TI V+++I L+ DP PD PL ++A +++ D++ + + + Sbjct: 93 GEICLDILKSESWSPAWTIEYVVVAILMLIDDPEPDSPLNLDLANLFRYDKDAFESMVQY 152 Query: 178 WTRKYAM**VNCDINKTYTHTSPQP 252 KY N Y PQP Sbjct: 153 TIWKY---------NTFYQENQPQP 168 >UniRef50_Q7QVV7 Cluster: Ubiquitin carrier protein; n=1; Giardia lamblia ATCC 50803|Rep: Ubiquitin carrier protein - Giardia lamblia ATCC 50803 Length = 159 Score = 59.3 bits (137), Expect = 5e-08 Identities = 31/63 (49%), Positives = 35/63 (55%), Gaps = 1/63 (1%) Frame = +1 Query: 1 GSICLDIL-RAQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELARE 177 G ICLDIL + +W P + VL SI SLLCDPNP DP + A Y DR Y RE Sbjct: 83 GKICLDILTKKEWKPVYDLGTVLTSIRSLLCDPNPKDPANCDAAYEYIYDRHLYEMKVRE 142 Query: 178 WTR 186 R Sbjct: 143 CVR 145 >UniRef50_A2F4E2 Cluster: Ubiquitin carrier protein; n=1; Trichomonas vaginalis G3|Rep: Ubiquitin carrier protein - Trichomonas vaginalis G3 Length = 150 Score = 59.3 bits (137), Expect = 5e-08 Identities = 25/65 (38%), Positives = 42/65 (64%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELAREW 180 G+ICL +L+ +WSP + I +L + L+ P+P D L EIA YK + ++Y A++W Sbjct: 84 GNICLSLLKNEWSPKVKIMDILEQVYLLISAPDPIDALNTEIAAEYKDNHDEYVRKAKQW 143 Query: 181 TRKYA 195 T+++A Sbjct: 144 TQEFA 148 >UniRef50_Q0UIW0 Cluster: Putative uncharacterized protein; n=1; Phaeosphaeria nodorum|Rep: Putative uncharacterized protein - Phaeosphaeria nodorum (Septoria nodorum) Length = 159 Score = 59.3 bits (137), Expect = 5e-08 Identities = 26/66 (39%), Positives = 43/66 (65%), Gaps = 1/66 (1%) Frame = +1 Query: 1 GSICLDILRAQ-WSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELARE 177 GS+CL +LR + W P + VL I +LL +PN DD + P IA Y+ +R+++ + A++ Sbjct: 93 GSMCLGLLRPESWKPPNKVVAVLRLIQTLLIEPNVDDAIEPSIANEYRENRKEFEKNAKD 152 Query: 178 WTRKYA 195 W ++YA Sbjct: 153 WVKRYA 158 >UniRef50_P49428 Cluster: Ubiquitin-conjugating enzyme E2-24 kDa; n=2; Pichia|Rep: Ubiquitin-conjugating enzyme E2-24 kDa - Pichia pastoris (Yeast) Length = 204 Score = 59.3 bits (137), Expect = 5e-08 Identities = 29/67 (43%), Positives = 42/67 (62%), Gaps = 1/67 (1%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYK-TDREKYNELARE 177 G ICLDIL+A+W+PA T+S L +I LL DP P PL ++A + K D + YN L Sbjct: 130 GEICLDILQAKWTPAWTLSSALTAIVLLLNDPEPLSPLDIDMANLMKINDLKAYNSLIEY 189 Query: 178 WTRKYAM 198 + +Y++ Sbjct: 190 YVGRYSI 196 >UniRef50_UPI0000D57489 Cluster: PREDICTED: similar to CG15437-PA; n=1; Tribolium castaneum|Rep: PREDICTED: similar to CG15437-PA - Tribolium castaneum Length = 392 Score = 58.8 bits (136), Expect = 7e-08 Identities = 30/66 (45%), Positives = 42/66 (63%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELAREW 180 G I +D + WS ALT+SK+L+SI SLL DP D + PEI ++ +RE + A+ W Sbjct: 321 GDIGIDSIHHNWSLALTLSKLLISIQSLLTDPFCDVCMEPEIGNMFLKNREAFELEAKMW 380 Query: 181 TRKYAM 198 T K+AM Sbjct: 381 TCKHAM 386 >UniRef50_A2GNR9 Cluster: Ubiquitin conjugating protein, putative; n=1; Trichomonas vaginalis G3|Rep: Ubiquitin conjugating protein, putative - Trichomonas vaginalis G3 Length = 151 Score = 58.8 bits (136), Expect = 7e-08 Identities = 27/57 (47%), Positives = 35/57 (61%) Frame = +1 Query: 7 ICLDILRAQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELARE 177 ICLDILR WSPA +S +LLSI LL +PNP PE ++Y +R +Y R+ Sbjct: 86 ICLDILRRNWSPAYNVSAILLSIQQLLTEPNPAANANPEACQLYIHNRSEYEHRVRQ 142 >UniRef50_A6SKB5 Cluster: Putative uncharacterized protein; n=2; Sclerotiniaceae|Rep: Putative uncharacterized protein - Botryotinia fuckeliana B05.10 Length = 153 Score = 58.4 bits (135), Expect = 9e-08 Identities = 31/67 (46%), Positives = 43/67 (64%), Gaps = 1/67 (1%) Frame = +1 Query: 1 GSICLDILRA-QWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELARE 177 GSIC+D L+ +W P+ I+ +L +I +LL PNPDDPL IA K D + + A+E Sbjct: 85 GSICVDELKQDKWKPSGKITAILGAIRNLLITPNPDDPLENTIADKLKNDADGFANEAKE 144 Query: 178 WTRKYAM 198 T+KYAM Sbjct: 145 NTKKYAM 151 >UniRef50_A5DY26 Cluster: Ubiquitin carrier protein; n=3; Saccharomycetaceae|Rep: Ubiquitin carrier protein - Lodderomyces elongisporus (Yeast) (Saccharomyces elongisporus) Length = 211 Score = 58.4 bits (135), Expect = 9e-08 Identities = 25/62 (40%), Positives = 39/62 (62%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELAREW 180 G+ICL+ILR WSP L+++ VL+ + L +PNP+DPL E A + D++++ R Sbjct: 137 GNICLNILREDWSPVLSLNSVLIGLNFLFLEPNPNDPLNKEAANMLVKDKKQFERNVRNL 196 Query: 181 TR 186 R Sbjct: 197 MR 198 >UniRef50_P68036 Cluster: Ubiquitin-conjugating enzyme E2 L3; n=66; Eumetazoa|Rep: Ubiquitin-conjugating enzyme E2 L3 - Homo sapiens (Human) Length = 154 Score = 58.4 bits (135), Expect = 9e-08 Identities = 25/65 (38%), Positives = 42/65 (64%), Gaps = 1/65 (1%) Frame = +1 Query: 1 GSICLDILRAQ-WSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELARE 177 G +CL ++ A+ W PA +V+ S+ +L+ DP P+ PL ++A Y DR+K+ + A E Sbjct: 83 GQVCLPVISAENWKPATKTDQVIQSLIALVNDPQPEHPLRADLAEEYSKDRKKFCKNAEE 142 Query: 178 WTRKY 192 +T+KY Sbjct: 143 FTKKY 147 >UniRef50_UPI00006CB320 Cluster: Ubiquitin-conjugating enzyme family protein; n=1; Tetrahymena thermophila SB210|Rep: Ubiquitin-conjugating enzyme family protein - Tetrahymena thermophila SB210 Length = 309 Score = 57.6 bits (133), Expect = 2e-07 Identities = 25/66 (37%), Positives = 40/66 (60%), Gaps = 1/66 (1%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVL-LSICSLLCDPNPDDPLVPEIARIYKTDREKYNELARE 177 GS+CLD++ WSP + + + + LL PNP DPL PE A I D+ +N++ ++ Sbjct: 84 GSVCLDVINQTWSPMYELINIFDIFLPQLLTYPNPKDPLNPEAAMILIKDQNIFNQVVQD 143 Query: 178 WTRKYA 195 + +KYA Sbjct: 144 FVKKYA 149 >UniRef50_Q4WNS9 Cluster: Ubiquitin carrier protein; n=4; Ascomycota|Rep: Ubiquitin carrier protein - Aspergillus fumigatus (Sartorya fumigata) Length = 190 Score = 57.6 bits (133), Expect = 2e-07 Identities = 26/61 (42%), Positives = 36/61 (59%), Gaps = 2/61 (3%) Frame = +1 Query: 1 GSICLDILRAQ--WSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELAR 174 G++CL IL + W PA+TI ++LL I LL DPNP+ P E ++K DR Y R Sbjct: 122 GTVCLSILNEEEAWKPAITIKQILLGIQDLLDDPNPESPAQAEAYNLFKKDRPAYERRVR 181 Query: 175 E 177 + Sbjct: 182 Q 182 >UniRef50_P52484 Cluster: Probable ubiquitin-conjugating enzyme E2 21; n=5; Caenorhabditis|Rep: Probable ubiquitin-conjugating enzyme E2 21 - Caenorhabditis elegans Length = 229 Score = 57.6 bits (133), Expect = 2e-07 Identities = 25/65 (38%), Positives = 40/65 (61%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELAREW 180 G+ICLDIL+ +W+ +LT+ VLLS+ ++LC P P DP +A+ + + + A W Sbjct: 118 GTICLDILKDKWTASLTLRTVLLSLQAMLCSPEPSDPQDAVVAKQFINNYPMFTATAVYW 177 Query: 181 TRKYA 195 T +A Sbjct: 178 TSYFA 182 >UniRef50_A5E394 Cluster: Putative uncharacterized protein; n=1; Lodderomyces elongisporus NRRL YB-4239|Rep: Putative uncharacterized protein - Lodderomyces elongisporus (Yeast) (Saccharomyces elongisporus) Length = 199 Score = 57.2 bits (132), Expect = 2e-07 Identities = 23/58 (39%), Positives = 37/58 (63%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELAR 174 G ICLDIL++QWSPA + ++++I L+ P PD PL + A +Y+ D+ + L + Sbjct: 93 GEICLDILKSQWSPAWNLESLVVAILQLMDHPEPDSPLNIDAANLYRADKLGFESLVQ 150 >UniRef50_Q4SUR6 Cluster: Ubiquitin carrier protein; n=1; Tetraodon nigroviridis|Rep: Ubiquitin carrier protein - Tetraodon nigroviridis (Green puffer) Length = 226 Score = 56.0 bits (129), Expect = 5e-07 Identities = 21/55 (38%), Positives = 35/55 (63%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNE 165 G++CL+ILR W P LTI+ ++ + L +PNP+DPL E A + + +R + + Sbjct: 151 GNVCLNILREDWKPVLTINSIIYGLQYLFLEPNPEDPLNKEAAEVLQNNRRLFEQ 205 >UniRef50_A2GLA4 Cluster: Ubiquitin-conjugating enzyme family protein; n=1; Trichomonas vaginalis G3|Rep: Ubiquitin-conjugating enzyme family protein - Trichomonas vaginalis G3 Length = 157 Score = 56.0 bits (129), Expect = 5e-07 Identities = 22/59 (37%), Positives = 38/59 (64%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELARE 177 G++C +IL +W P+ I +L+SI L+ +PN ++P PEIA++Y + +YN + E Sbjct: 84 GNVCHNILFNEWDPSYNIYTILISIYLLIIEPNTNEPANPEIAQLYTNNNAEYNRMVHE 142 >UniRef50_A2D9T6 Cluster: Ubiquitin carrier protein; n=1; Trichomonas vaginalis G3|Rep: Ubiquitin carrier protein - Trichomonas vaginalis G3 Length = 150 Score = 56.0 bits (129), Expect = 5e-07 Identities = 23/65 (35%), Positives = 39/65 (60%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELAREW 180 G ICLD+L +W P+ ++ +L+SI S L DPNP+ L E +++ +++ Y R++ Sbjct: 82 GGICLDLLIDKWLPSYNVASLLVSIRSFLDDPNPEHGLNSEALEMFRNNKDGYKRTVRQY 141 Query: 181 TRKYA 195 YA Sbjct: 142 INSYA 146 >UniRef50_Q7RY50 Cluster: Putative uncharacterized protein NCU04513.1; n=4; Sordariomycetes|Rep: Putative uncharacterized protein NCU04513.1 - Neurospora crassa Length = 204 Score = 56.0 bits (129), Expect = 5e-07 Identities = 28/71 (39%), Positives = 44/71 (61%), Gaps = 1/71 (1%) Frame = +1 Query: 1 GSICLDILRAQ-WSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELARE 177 G+ICL +L+++ W PA I VL ++ ++L +P PDD L IA Y+ DR ++ + AR Sbjct: 86 GNICLGLLKSENWKPASKIISVLEAVRNILVEPMPDDALEQRIADEYRRDRPEFEKNARA 145 Query: 178 WTRKYAM**VN 210 + +YA VN Sbjct: 146 YVERYAKGSVN 156 >UniRef50_Q6CPL4 Cluster: Kluyveromyces lactis strain NRRL Y-1140 chromosome E of strain NRRL Y- 1140 of Kluyveromyces lactis; n=1; Kluyveromyces lactis|Rep: Kluyveromyces lactis strain NRRL Y-1140 chromosome E of strain NRRL Y- 1140 of Kluyveromyces lactis - Kluyveromyces lactis (Yeast) (Candida sphaerica) Length = 158 Score = 56.0 bits (129), Expect = 5e-07 Identities = 26/58 (44%), Positives = 36/58 (62%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELAR 174 G ICLD+L+ W+P T+ V+ +I LL DP D PL +IA+IY D E Y ++ R Sbjct: 90 GEICLDLLKDAWTPIYTLLDVVGAIRDLLADPGLDSPLDLDIAQIYDADYEAYVQIVR 147 >UniRef50_Q6C713 Cluster: Similarities with DEHA0D15444g Debaryomyces hansenii; n=1; Yarrowia lipolytica|Rep: Similarities with DEHA0D15444g Debaryomyces hansenii - Yarrowia lipolytica (Candida lipolytica) Length = 153 Score = 56.0 bits (129), Expect = 5e-07 Identities = 26/66 (39%), Positives = 38/66 (57%), Gaps = 1/66 (1%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNE-LARE 177 G +C+D+L+ QWSPA TIS ++ ++L P PD PL + A + + E E L R Sbjct: 85 GEVCIDVLKTQWSPAWTISSACTAVSAMLSLPEPDSPLNIDAANLVRCGDESAMEGLVRY 144 Query: 178 WTRKYA 195 + KYA Sbjct: 145 YVNKYA 150 >UniRef50_P61081 Cluster: NEDD8-conjugating enzyme Ubc12; n=24; Eukaryota|Rep: NEDD8-conjugating enzyme Ubc12 - Homo sapiens (Human) Length = 183 Score = 56.0 bits (129), Expect = 5e-07 Identities = 21/55 (38%), Positives = 35/55 (63%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNE 165 G++CL+ILR W P LTI+ ++ + L +PNP+DPL E A + + +R + + Sbjct: 108 GNVCLNILREDWKPVLTINSIIYGLQYLFLEPNPEDPLNKEAAEVLQNNRRLFEQ 162 >UniRef50_Q8LGF7 Cluster: Ubiquitin carrier protein; n=7; Eukaryota|Rep: Ubiquitin carrier protein - Arabidopsis thaliana (Mouse-ear cress) Length = 157 Score = 55.6 bits (128), Expect = 7e-07 Identities = 27/67 (40%), Positives = 40/67 (59%), Gaps = 1/67 (1%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKT-DREKYNELARE 177 G ICLDIL+ WSPA T+ V +I +L+ P PD PL + + ++ D +N +A+ Sbjct: 87 GEICLDILKNAWSPAWTLQSVCRAIIALMAHPEPDSPLNCDSGNLLRSGDVRGFNSMAQM 146 Query: 178 WTRKYAM 198 +TR AM Sbjct: 147 YTRLAAM 153 >UniRef50_Q5UQC9 Cluster: Probable ubiquitin-conjugating enzyme E2 L460; n=1; Acanthamoeba polyphaga mimivirus|Rep: Probable ubiquitin-conjugating enzyme E2 L460 - Mimivirus Length = 158 Score = 55.6 bits (128), Expect = 7e-07 Identities = 24/66 (36%), Positives = 42/66 (63%), Gaps = 1/66 (1%) Frame = +1 Query: 1 GSICLDILRAQ-WSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELARE 177 G ICL+IL+ W+ +L I ++ SI LL PNP+DP E+A +Y+ D+ Y++ R+ Sbjct: 88 GDICLNILKKDGWNASLNIISIIWSIIVLLDQPNPEDPFNSELASLYRNDKLSYDKKIRD 147 Query: 178 WTRKYA 195 + + ++ Sbjct: 148 YCKTHS 153 >UniRef50_UPI00015B62F0 Cluster: PREDICTED: hypothetical protein; n=1; Nasonia vitripennis|Rep: PREDICTED: hypothetical protein - Nasonia vitripennis Length = 154 Score = 55.2 bits (127), Expect = 9e-07 Identities = 24/76 (31%), Positives = 48/76 (63%), Gaps = 4/76 (5%) Frame = +1 Query: 1 GSICLDILRAQ----WSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNEL 168 G IC+D+L+ W P +++ +++++ SLL +PNPDDPL+ +IA Y+ ++ ++ Sbjct: 82 GRICMDLLKMPPNGGWKPTISLENLIVAVQSLLGNPNPDDPLMVDIAEEYRFNKTEFERK 141 Query: 169 AREWTRKYAM**VNCD 216 A+++ ++ NCD Sbjct: 142 AKKYAQENGK---NCD 154 >UniRef50_Q6LFK4 Cluster: Ubiquitin-conjugating enzyme E2, putative; n=5; Plasmodium|Rep: Ubiquitin-conjugating enzyme E2, putative - Plasmodium falciparum (isolate 3D7) Length = 155 Score = 55.2 bits (127), Expect = 9e-07 Identities = 26/67 (38%), Positives = 41/67 (61%), Gaps = 1/67 (1%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKT-DREKYNELARE 177 G +C+DIL+A WSPA TI + +I L +PN D PL + + ++ D + + +AR Sbjct: 83 GELCMDILKANWSPAWTIQSLCRAILFLFNEPNADSPLNCDAGNLIRSGDIKGFQSMARM 142 Query: 178 WTRKYAM 198 +T +YAM Sbjct: 143 YTVEYAM 149 >UniRef50_A0CVS4 Cluster: Chromosome undetermined scaffold_295, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_295, whole genome shotgun sequence - Paramecium tetraurelia Length = 152 Score = 55.2 bits (127), Expect = 9e-07 Identities = 24/66 (36%), Positives = 40/66 (60%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELAREW 180 G I L IL+ W+ T+ K+L SI LL +P+ D+ P+ +YK ++ + + A+EW Sbjct: 85 GYIYLGILKDDWTSDYTVHKILTSIKQLLKNPDEDNSFFPDATLLYKNNKIDFEKKAKEW 144 Query: 181 TRKYAM 198 +KYA+ Sbjct: 145 AQKYAI 150 >UniRef50_Q0R0E6 Cluster: Ubiquitin carrier protein; n=1; Symbiodinium sp. C3|Rep: Ubiquitin carrier protein - Symbiodinium sp. C3 Length = 268 Score = 54.8 bits (126), Expect = 1e-06 Identities = 24/45 (53%), Positives = 33/45 (73%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARI 135 G+ICLDIL+ WSP+L++ K L SI +L+ DPNPDD + IA + Sbjct: 207 GAICLDILKDSWSPSLSVFKCLESIRALMADPNPDDAMRQWIAEL 251 >UniRef50_Q4CQP3 Cluster: Ubiquitin carrier protein; n=4; Trypanosomatidae|Rep: Ubiquitin carrier protein - Trypanosoma cruzi Length = 238 Score = 54.8 bits (126), Expect = 1e-06 Identities = 25/66 (37%), Positives = 41/66 (62%), Gaps = 2/66 (3%) Frame = +1 Query: 1 GSICLDILRAQ--WSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELAR 174 G++CL IL + W P++TI ++LL+I LL +PN DP E ++Y DR++Y + R Sbjct: 167 GTVCLSILNEEKDWRPSITIKQILLAIQELLDNPNIKDPAQEEPYKVYMRDRKEYEDRVR 226 Query: 175 EWTRKY 192 + K+ Sbjct: 227 QEVAKH 232 >UniRef50_A2EHU5 Cluster: Ubiquitin carrier protein; n=1; Trichomonas vaginalis G3|Rep: Ubiquitin carrier protein - Trichomonas vaginalis G3 Length = 173 Score = 54.8 bits (126), Expect = 1e-06 Identities = 25/69 (36%), Positives = 43/69 (62%), Gaps = 4/69 (5%) Frame = +1 Query: 1 GSICLDILRAQ----WSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNEL 168 G ICLD L+ Q W+ +++ +L I L+ +PNP+DPL +IA+ + ++ K+ E Sbjct: 86 GRICLDFLKPQPQGKWTATVSLEMLLTQIQQLMAEPNPNDPLDTKIAQEFTENKAKFLET 145 Query: 169 AREWTRKYA 195 A++WT +A Sbjct: 146 AKKWTDVHA 154 >UniRef50_Q6BRS6 Cluster: Similarities with CA4803|CaPEX4 Candida albicans CaPEX4; n=4; Saccharomycetales|Rep: Similarities with CA4803|CaPEX4 Candida albicans CaPEX4 - Debaryomyces hansenii (Yeast) (Torulaspora hansenii) Length = 568 Score = 54.8 bits (126), Expect = 1e-06 Identities = 23/65 (35%), Positives = 41/65 (63%), Gaps = 1/65 (1%) Frame = +1 Query: 1 GSICLDILRAQ-WSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELARE 177 G ICLDIL+ + WSPA + ++++I L+ DP PD PL ++A +++ D+ + + + Sbjct: 94 GEICLDILKQEGWSPAWNLQYLVVAILMLIDDPEPDSPLNIDLANLFRQDKTAFESVVQY 153 Query: 178 WTRKY 192 + KY Sbjct: 154 YMWKY 158 >UniRef50_UPI0000D56950 Cluster: PREDICTED: similar to Ubiquitin-conjugating enzyme E2 T (Ubiquitin-protein ligase T) (Ubiquitin carrier protein T); n=1; Tribolium castaneum|Rep: PREDICTED: similar to Ubiquitin-conjugating enzyme E2 T (Ubiquitin-protein ligase T) (Ubiquitin carrier protein T) - Tribolium castaneum Length = 151 Score = 54.4 bits (125), Expect = 2e-06 Identities = 26/69 (37%), Positives = 43/69 (62%), Gaps = 4/69 (5%) Frame = +1 Query: 1 GSICLDILR----AQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNEL 168 G ICLD+++ W P + + +L++I LL PNP+DPL+ EIA Y+ ++ + Sbjct: 82 GRICLDLIKMPPKGNWRPTIGLEGLLIAIRMLLETPNPEDPLMAEIAEEYRNMNSEFVKK 141 Query: 169 AREWTRKYA 195 A+ +T+KYA Sbjct: 142 AQLFTQKYA 150 >UniRef50_UPI0000498C2E Cluster: ubiquitin-conjugating enzyme; n=3; Entamoeba histolytica HM-1:IMSS|Rep: ubiquitin-conjugating enzyme - Entamoeba histolytica HM-1:IMSS Length = 161 Score = 54.0 bits (124), Expect = 2e-06 Identities = 28/66 (42%), Positives = 42/66 (63%), Gaps = 1/66 (1%) Frame = +1 Query: 1 GSICLDILRAQ-WSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELARE 177 G ICLD L+ Q W A+ IS VL +I LL +PN +DPL E+ ++ ++ + AR+ Sbjct: 93 GKICLDTLKPQGWVCAMQISSVLQTIQQLLANPNLEDPLNLEVNNLWLSNPAQAKSNARD 152 Query: 178 WTRKYA 195 +T+KYA Sbjct: 153 YTQKYA 158 >UniRef50_P52491 Cluster: NEDD8-conjugating enzyme UBC12; n=3; Saccharomycetales|Rep: NEDD8-conjugating enzyme UBC12 - Saccharomyces cerevisiae (Baker's yeast) Length = 188 Score = 54.0 bits (124), Expect = 2e-06 Identities = 21/58 (36%), Positives = 36/58 (62%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELAR 174 G++CL+ILR WSPAL + ++ + L +PNP+DPL + A++ +++ E R Sbjct: 112 GNVCLNILREDWSPALDLQSIITGLLFLFLEPNPNDPLNKDAAKLLCEGEKEFAEAVR 169 >UniRef50_Q54TI6 Cluster: Ubiquitin carrier protein; n=1; Dictyostelium discoideum AX4|Rep: Ubiquitin carrier protein - Dictyostelium discoideum AX4 Length = 230 Score = 53.6 bits (123), Expect = 3e-06 Identities = 22/62 (35%), Positives = 36/62 (58%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELAREW 180 G +CL+ILR W P L I V+ + +L +PNPDDPL + A++ +++ + R+ Sbjct: 156 GHVCLNILRQDWMPVLNIGTVIFGLMTLFLEPNPDDPLNKDAAQLMIDNKKTFEANVRQS 215 Query: 181 TR 186 R Sbjct: 216 LR 217 >UniRef50_A2E5I6 Cluster: Ubiquitin carrier protein; n=1; Trichomonas vaginalis G3|Rep: Ubiquitin carrier protein - Trichomonas vaginalis G3 Length = 162 Score = 53.6 bits (123), Expect = 3e-06 Identities = 24/64 (37%), Positives = 39/64 (60%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELAREW 180 G +CL+ILR +++PA+ +S ++L I L +PNP+DPL E A + D K+ A ++ Sbjct: 91 GPVCLNILREKYTPAIPLSNLILGIQYLFLEPNPNDPLNVEAAEEFTKDNIKFRVHAHDY 150 Query: 181 TRKY 192 Y Sbjct: 151 MLHY 154 >UniRef50_P63279 Cluster: SUMO-conjugating enzyme UBC9; n=74; Eukaryota|Rep: SUMO-conjugating enzyme UBC9 - Homo sapiens (Human) Length = 158 Score = 53.6 bits (123), Expect = 3e-06 Identities = 27/67 (40%), Positives = 38/67 (56%), Gaps = 2/67 (2%) Frame = +1 Query: 1 GSICLDILRAQ--WSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELAR 174 G++CL IL W PA+TI ++LL I LL +PN DP E IY +R +Y + R Sbjct: 90 GTVCLSILEEDKDWRPAITIKQILLGIQELLNEPNIQDPAQAEAYTIYCQNRVEYEKRVR 149 Query: 175 EWTRKYA 195 +K+A Sbjct: 150 AQAKKFA 156 >UniRef50_Q9P6I1 Cluster: Ubiquitin-conjugating enzyme E2 16; n=1; Schizosaccharomyces pombe|Rep: Ubiquitin-conjugating enzyme E2 16 - Schizosaccharomyces pombe (Fission yeast) Length = 160 Score = 53.6 bits (123), Expect = 3e-06 Identities = 26/66 (39%), Positives = 39/66 (59%), Gaps = 1/66 (1%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKT-DREKYNELARE 177 G +C+DIL+ WSPA ++ L+I SLL + + PL + A++ +T D+ YN L R Sbjct: 87 GEVCMDILKTHWSPAWSLQSACLAIISLLSNYDASSPLNVDAAKLLRTGDKTAYNSLVRC 146 Query: 178 WTRKYA 195 T YA Sbjct: 147 TTYLYA 152 >UniRef50_A2WTE6 Cluster: Putative uncharacterized protein; n=1; Oryza sativa (indica cultivar-group)|Rep: Putative uncharacterized protein - Oryza sativa subsp. indica (Rice) Length = 72 Score = 53.2 bits (122), Expect = 3e-06 Identities = 23/28 (82%), Positives = 25/28 (89%) Frame = +1 Query: 58 KVLLSICSLLCDPNPDDPLVPEIARIYK 141 +VLLSICS+L DPNPDDPLVPEIA YK Sbjct: 40 EVLLSICSVLTDPNPDDPLVPEIAHTYK 67 >UniRef50_Q54VW9 Cluster: Ubiquitin carrier protein; n=1; Dictyostelium discoideum AX4|Rep: Ubiquitin carrier protein - Dictyostelium discoideum AX4 Length = 185 Score = 52.8 bits (121), Expect = 5e-06 Identities = 25/66 (37%), Positives = 36/66 (54%), Gaps = 1/66 (1%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVL-LSICSLLCDPNPDDPLVPEIARIYKTDREKYNELARE 177 GS+CLD++ WSP + + + + LL PNP DPL E A + + EKY +E Sbjct: 82 GSVCLDVINQTWSPMFDLINIFEIFLPQLLLYPNPTDPLNGEAASMLLKEPEKYKIKVKE 141 Query: 178 WTRKYA 195 + KYA Sbjct: 142 FVNKYA 147 >UniRef50_Q22BX5 Cluster: Ubiquitin carrier protein; n=5; Tetrahymena thermophila SB210|Rep: Ubiquitin carrier protein - Tetrahymena thermophila SB210 Length = 549 Score = 52.8 bits (121), Expect = 5e-06 Identities = 27/59 (45%), Positives = 36/59 (61%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELARE 177 G ICL+IL+ +WS LTI KVL+SI SLL + N DD +YK D E + L ++ Sbjct: 439 GEICLNILQDKWSTVLTIQKVLVSIVSLLYEKNLDDVYNHYAKTLYKEDPEGFKTLIKK 497 >UniRef50_Q753J8 Cluster: AFR314Wp; n=1; Eremothecium gossypii|Rep: AFR314Wp - Ashbya gossypii (Yeast) (Eremothecium gossypii) Length = 155 Score = 52.8 bits (121), Expect = 5e-06 Identities = 22/55 (40%), Positives = 37/55 (67%), Gaps = 1/55 (1%) Frame = +1 Query: 1 GSICLDILRAQ-WSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYN 162 G +CLD+L+ + WSP + +V+ +I +LL +P D PL +++R+Y TDR Y+ Sbjct: 88 GEVCLDLLKHEAWSPVYNLLQVVEAISTLLAEPGVDSPLDVDLSRLYTTDRAAYD 142 >UniRef50_A7TRY4 Cluster: Putative uncharacterized protein; n=1; Vanderwaltozyma polyspora DSM 70294|Rep: Putative uncharacterized protein - Vanderwaltozyma polyspora DSM 70294 Length = 192 Score = 52.8 bits (121), Expect = 5e-06 Identities = 22/59 (37%), Positives = 35/59 (59%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELARE 177 G ICL+ILR WSPAL ++ +++ + L + N DPL E A I +D + + + R+ Sbjct: 118 GKICLNILREDWSPALDLNSIIIGLLYLFLECNAKDPLNKEAANILHSDEDMFRKYVRD 176 >UniRef50_P28263 Cluster: Ubiquitin-conjugating enzyme E2-24 kDa; n=13; Eukaryota|Rep: Ubiquitin-conjugating enzyme E2-24 kDa - Saccharomyces cerevisiae (Baker's yeast) Length = 218 Score = 52.8 bits (121), Expect = 5e-06 Identities = 26/66 (39%), Positives = 38/66 (57%), Gaps = 1/66 (1%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVL-LSICSLLCDPNPDDPLVPEIARIYKTDREKYNELARE 177 GSICLD++ + WSP + ++ I LL +PN DPL E A + D++ Y E +E Sbjct: 82 GSICLDVINSTWSPLYDLINIVEWMIPGLLKEPNGSDPLNNEAATLQLRDKKLYEEKIKE 141 Query: 178 WTRKYA 195 + KYA Sbjct: 142 YIDKYA 147 >UniRef50_A0C3F7 Cluster: Ubiquitin carrier protein; n=2; Paramecium tetraurelia|Rep: Ubiquitin carrier protein - Paramecium tetraurelia Length = 167 Score = 52.4 bits (120), Expect = 6e-06 Identities = 25/67 (37%), Positives = 39/67 (58%), Gaps = 1/67 (1%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYK-TDREKYNELARE 177 G +CL++L +W P TI VL ++ +L +PNP PL + A + K D Y +A+ Sbjct: 84 GEVCLEVLSQKWEPRWTIESVLRAVRLMLQEPNPYSPLNCDAANLLKANDLIGYKSIAQY 143 Query: 178 WTRKYAM 198 +T KYA+ Sbjct: 144 YTSKYAI 150 >UniRef50_Q1E8C5 Cluster: Ubiquitin carrier protein; n=9; Pezizomycotina|Rep: Ubiquitin carrier protein - Coccidioides immitis Length = 257 Score = 52.4 bits (120), Expect = 6e-06 Identities = 25/66 (37%), Positives = 35/66 (53%), Gaps = 1/66 (1%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVL-LSICSLLCDPNPDDPLVPEIARIYKTDREKYNELARE 177 GS+CLD++ WSP + + + + LL PNP DPL + A + D KY RE Sbjct: 154 GSVCLDVINQTWSPMYDMINIFEVFLPQLLRYPNPSDPLNGDAAAVLLRDPSKYEAKVRE 213 Query: 178 WTRKYA 195 + KYA Sbjct: 214 YVAKYA 219 >UniRef50_P16577 Cluster: Ubiquitin-conjugating enzyme E2-23 kDa; n=8; Eukaryota|Rep: Ubiquitin-conjugating enzyme E2-23 kDa - Triticum aestivum (Wheat) Length = 184 Score = 52.4 bits (120), Expect = 6e-06 Identities = 23/66 (34%), Positives = 35/66 (53%), Gaps = 1/66 (1%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVL-LSICSLLCDPNPDDPLVPEIARIYKTDREKYNELARE 177 GS+CLD++ WSP + + + + LL PNP DPL E A + D+ Y +E Sbjct: 82 GSVCLDVINQTWSPMFDLVNIFEVFLPQLLLYPNPSDPLNGEAASLMMRDKNAYENKVKE 141 Query: 178 WTRKYA 195 + +YA Sbjct: 142 YCERYA 147 >UniRef50_Q8IJ70 Cluster: Ubiquitin carrier protein; n=9; Aconoidasida|Rep: Ubiquitin carrier protein - Plasmodium falciparum (isolate 3D7) Length = 191 Score = 52.0 bits (119), Expect = 8e-06 Identities = 23/66 (34%), Positives = 37/66 (56%), Gaps = 1/66 (1%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVL-LSICSLLCDPNPDDPLVPEIARIYKTDREKYNELARE 177 GS+CLD++ W+P ++ V + + LL PNP DPL + A + D+ Y E +E Sbjct: 84 GSVCLDVINQTWTPLYSLVNVFEVFLPQLLTYPNPSDPLNSDAASLLMKDKNIYEEKVKE 143 Query: 178 WTRKYA 195 + + YA Sbjct: 144 YVKLYA 149 >UniRef50_Q4N5Y1 Cluster: Ubiquitin carrier protein; n=3; Piroplasmida|Rep: Ubiquitin carrier protein - Theileria parva Length = 157 Score = 52.0 bits (119), Expect = 8e-06 Identities = 23/67 (34%), Positives = 39/67 (58%), Gaps = 1/67 (1%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYK-TDREKYNELARE 177 G +C+DIL++ WSPA TI + + +L PNPD PL + + + D Y +A+ Sbjct: 85 GELCIDILKSNWSPAWTIQYLCRGVIYILSTPNPDSPLNCDAGNLVRYGDLIGYKSMAKM 144 Query: 178 WTRKYAM 198 +T ++A+ Sbjct: 145 YTHEHAL 151 >UniRef50_P52492 Cluster: Ubiquitin-conjugating enzyme E2-18 kDa; n=6; Eukaryota|Rep: Ubiquitin-conjugating enzyme E2-18 kDa - Saccharomyces cerevisiae (Baker's yeast) Length = 156 Score = 52.0 bits (119), Expect = 8e-06 Identities = 23/55 (41%), Positives = 34/55 (61%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNE 165 G+ICLDIL+ +WS + +LLS+ SLL +PN PL A ++ D E+Y + Sbjct: 90 GNICLDILKEKWSAVYNVETILLSLQSLLGEPNNRSPLNAVAAELWDADMEEYRK 144 >UniRef50_Q9C6Q4 Cluster: Ubiquitin carrier protein; n=10; Eukaryota|Rep: Ubiquitin carrier protein - Arabidopsis thaliana (Mouse-ear cress) Length = 195 Score = 51.6 bits (118), Expect = 1e-05 Identities = 24/59 (40%), Positives = 41/59 (69%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELARE 177 G+ICLDIL+ +WS A + +LLSI SLL +PN PL + A+++ +++E+Y ++ + Sbjct: 131 GNICLDILQDKWSSAYDVRTILLSIQSLLGEPNISSPLNTQAAQLW-SNQEEYRKMVEK 188 >UniRef50_A2FAR7 Cluster: Ubiquitin carrier protein; n=1; Trichomonas vaginalis G3|Rep: Ubiquitin carrier protein - Trichomonas vaginalis G3 Length = 162 Score = 51.6 bits (118), Expect = 1e-05 Identities = 25/66 (37%), Positives = 39/66 (59%), Gaps = 1/66 (1%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYK-TDREKYNELARE 177 G+ICLDIL+ +W+PA TI+ + +I LL P PD PL + + D+ Y+ +A+ Sbjct: 84 GTICLDILKTEWTPAWTINSLCTAIRLLLSHPEPDSPLNTLAGNLLRYNDQIGYDSMAKF 143 Query: 178 WTRKYA 195 + YA Sbjct: 144 YADTYA 149 >UniRef50_A2EP72 Cluster: Ubiquitin carrier protein; n=1; Trichomonas vaginalis G3|Rep: Ubiquitin carrier protein - Trichomonas vaginalis G3 Length = 170 Score = 51.6 bits (118), Expect = 1e-05 Identities = 19/49 (38%), Positives = 33/49 (67%) Frame = +1 Query: 31 QWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELARE 177 +W P T+ +++S+ S+L DPNP+ P+ E A+IYK D ++Y + R+ Sbjct: 111 RWLPIHTVESIIISVLSMLSDPNPESPMNIEAAKIYKNDIDEYKKRVRK 159 >UniRef50_P42750 Cluster: Ubiquitin-conjugating enzyme E2-21 kDa 3; n=10; Eukaryota|Rep: Ubiquitin-conjugating enzyme E2-21 kDa 3 - Arabidopsis thaliana (Mouse-ear cress) Length = 183 Score = 51.6 bits (118), Expect = 1e-05 Identities = 25/66 (37%), Positives = 33/66 (50%), Gaps = 1/66 (1%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVLLSIC-SLLCDPNPDDPLVPEIARIYKTDREKYNELARE 177 G++CLD++ WSP + V S LL PNP DP E A + DR Y +E Sbjct: 82 GAVCLDVINQTWSPMFDLINVFESFLPQLLLYPNPSDPFNGEAASLLMRDRAAYELKVKE 141 Query: 178 WTRKYA 195 + KYA Sbjct: 142 YCEKYA 147 >UniRef50_Q8I4X8 Cluster: Ubiquitin carrier protein; n=2; Plasmodium|Rep: Ubiquitin carrier protein - Plasmodium falciparum (isolate 3D7) Length = 157 Score = 51.2 bits (117), Expect = 1e-05 Identities = 18/56 (32%), Positives = 36/56 (64%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNEL 168 G++CL++L+ +W+P + + ++L + LL +P+ DDP A ++K D K+ E+ Sbjct: 89 GNVCLNVLKLEWNPIINLQMLILGLLLLLDEPSTDDPFNKIAAEVFKNDIYKFQEI 144 >UniRef50_Q4Y3H7 Cluster: Ubiquitin carrier protein; n=1; Plasmodium chabaudi|Rep: Ubiquitin carrier protein - Plasmodium chabaudi Length = 118 Score = 51.2 bits (117), Expect = 1e-05 Identities = 17/56 (30%), Positives = 37/56 (66%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNEL 168 G++CL++L+ W+P + + ++L + LL +P+ +DP + A + K D++K+ E+ Sbjct: 54 GNVCLNVLKLDWNPIINLQMLILGLILLLNEPSTNDPFNADAANVLKNDKQKFIEI 109 >UniRef50_A7F3W6 Cluster: Putative uncharacterized protein; n=2; Sclerotiniaceae|Rep: Putative uncharacterized protein - Sclerotinia sclerotiorum 1980 Length = 632 Score = 51.2 bits (117), Expect = 1e-05 Identities = 23/49 (46%), Positives = 33/49 (67%) Frame = +1 Query: 49 TISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELAREWTRKYA 195 +I +L ++C LL P+ DDPLVPEIA Y + ++Y AR +T+KYA Sbjct: 522 SIGALLTALCDLLSSPDVDDPLVPEIAHTYHKNFDEYCSNARLYTKKYA 570 >UniRef50_A2DXW4 Cluster: Ubiquitin carrier protein; n=2; Trichomonas vaginalis|Rep: Ubiquitin carrier protein - Trichomonas vaginalis G3 Length = 164 Score = 50.8 bits (116), Expect = 2e-05 Identities = 22/64 (34%), Positives = 37/64 (57%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELAREW 180 G++CL ILR + L+IS+ + + L +PNP+ PL E A ++K + K+ E ++ Sbjct: 98 GAVCLSILRDNYLATLSISQFVAGLQYLFIEPNPNSPLNTEAATMFKNEPAKFQETVDDY 157 Query: 181 TRKY 192 KY Sbjct: 158 IEKY 161 >UniRef50_Q5A7Q5 Cluster: Ubiquitin carrier protein; n=2; Ascomycota|Rep: Ubiquitin carrier protein - Candida albicans (Yeast) Length = 194 Score = 50.8 bits (116), Expect = 2e-05 Identities = 21/53 (39%), Positives = 34/53 (64%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKY 159 G+ICL+ILR WSP L+++ V + + L DPN DPL + A + +R+++ Sbjct: 120 GNICLNILREDWSPVLSLTGVFMGLNFLFLDPNATDPLNKDAANVLVKNRKQF 172 >UniRef50_Q24HQ3 Cluster: Ubiquitin carrier protein; n=1; Tetrahymena thermophila SB210|Rep: Ubiquitin carrier protein - Tetrahymena thermophila SB210 Length = 601 Score = 50.4 bits (115), Expect = 2e-05 Identities = 24/55 (43%), Positives = 32/55 (58%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNE 165 G IC+DIL+ WSPALT++ V SI L+ PNP D L IA + + Y + Sbjct: 490 GRICIDILKDNWSPALTMAAVFNSISELMLHPNPIDALESNIAAEMNHEYDLYKQ 544 >UniRef50_A2FS62 Cluster: Ubiquitin carrier protein; n=1; Trichomonas vaginalis G3|Rep: Ubiquitin carrier protein - Trichomonas vaginalis G3 Length = 149 Score = 50.4 bits (115), Expect = 2e-05 Identities = 23/54 (42%), Positives = 31/54 (57%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYN 162 GSIC+DIL+ WS A + ++ SI SLL PNP P E +Y + +YN Sbjct: 84 GSICIDILQQNWSNAYDAAAIMTSIISLLVLPNPHSPANNEAGELYVKNTNEYN 137 >UniRef50_UPI000155BB09 Cluster: PREDICTED: hypothetical protein; n=1; Ornithorhynchus anatinus|Rep: PREDICTED: hypothetical protein - Ornithorhynchus anatinus Length = 789 Score = 50.0 bits (114), Expect = 3e-05 Identities = 23/47 (48%), Positives = 31/47 (65%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYK 141 G+ICLDIL+ +WS + +LLSI SLL +PN D PL A ++K Sbjct: 717 GNICLDILKDKWSALYDVRTILLSIQSLLGEPNVDSPLNTHAAELWK 763 >UniRef50_Q4QIK2 Cluster: Ubiquitin carrier protein; n=6; Trypanosomatidae|Rep: Ubiquitin carrier protein - Leishmania major Length = 182 Score = 50.0 bits (114), Expect = 3e-05 Identities = 23/59 (38%), Positives = 34/59 (57%), Gaps = 1/59 (1%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKT-DREKYNELAR 174 G++CLDIL+ +WSP T+S V +I +LL +P D P + + + D E Y L R Sbjct: 107 GNVCLDILKKRWSPVWTLSSVCRAILNLLAEPESDSPFNCDAGNLLRAGDMEGYASLVR 165 >UniRef50_Q4QBT6 Cluster: Ubiquitin-conjugating enzyme-like protein; n=3; Leishmania|Rep: Ubiquitin-conjugating enzyme-like protein - Leishmania major Length = 260 Score = 50.0 bits (114), Expect = 3e-05 Identities = 23/58 (39%), Positives = 34/58 (58%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELAR 174 G+IC+D L++ W +L + +L+SI SLL DPNP AR+ +R Y+E R Sbjct: 176 GNICMDTLKSSWQSSLNLEALLISIQSLLSDPNPLSAANGAAARLLTENRSAYDEKIR 233 >UniRef50_A6NP33 Cluster: Uncharacterized protein UBE2C; n=14; Theria|Rep: Uncharacterized protein UBE2C - Homo sapiens (Human) Length = 150 Score = 50.0 bits (114), Expect = 3e-05 Identities = 23/47 (48%), Positives = 31/47 (65%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYK 141 G+ICLDIL+ +WS + +LLSI SLL +PN D PL A ++K Sbjct: 82 GNICLDILKEKWSALYDVRTILLSIQSLLGEPNIDSPLNTHAAELWK 128 >UniRef50_Q4PBN3 Cluster: Ubiquitin carrier protein; n=1; Ustilago maydis|Rep: Ubiquitin carrier protein - Ustilago maydis (Smut fungus) Length = 269 Score = 50.0 bits (114), Expect = 3e-05 Identities = 23/65 (35%), Positives = 35/65 (53%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELAREW 180 G IC+ L+ W I ++L +I LL +PNPD L E +R+ + + + Y E A W Sbjct: 143 GDICVSSLKKDWKKEYGIERILTTIKCLLIEPNPDSALDAEASRLMQENWDHYAETASLW 202 Query: 181 TRKYA 195 T +A Sbjct: 203 TSVHA 207 >UniRef50_Q1DRT9 Cluster: Ubiquitin carrier protein; n=1; Coccidioides immitis|Rep: Ubiquitin carrier protein - Coccidioides immitis Length = 469 Score = 50.0 bits (114), Expect = 3e-05 Identities = 23/65 (35%), Positives = 35/65 (53%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELAREW 180 G++C+D L+ W P LT+ VL++I LL PNPD L + + D E + A+ Sbjct: 97 GAVCVDTLKRDWEPKLTLRDVLITISCLLIHPNPDSALNSAAGALLQDDYEAFARQAKLM 156 Query: 181 TRKYA 195 T +A Sbjct: 157 TSIHA 161 >UniRef50_A7TMT8 Cluster: Putative uncharacterized protein; n=1; Vanderwaltozyma polyspora DSM 70294|Rep: Putative uncharacterized protein - Vanderwaltozyma polyspora DSM 70294 Length = 223 Score = 50.0 bits (114), Expect = 3e-05 Identities = 25/66 (37%), Positives = 37/66 (56%), Gaps = 1/66 (1%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVL-LSICSLLCDPNPDDPLVPEIARIYKTDREKYNELARE 177 GSICLD++ + WSP + ++ I LL +PN DPL E A + D+ Y + +E Sbjct: 83 GSICLDVINSTWSPLYDLLNIVEWMIPGLLKEPNGSDPLNNEAAGLQLHDKTLYEQKIKE 142 Query: 178 WTRKYA 195 + KYA Sbjct: 143 YIDKYA 148 >UniRef50_A6RMU5 Cluster: Ubiquitin carrier protein; n=6; Ascomycota|Rep: Ubiquitin carrier protein - Botryotinia fuckeliana B05.10 Length = 223 Score = 50.0 bits (114), Expect = 3e-05 Identities = 24/55 (43%), Positives = 35/55 (63%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNE 165 G ICLDIL+ +W+ A I VLLS+ SLL +PN PL E A ++ + E++ + Sbjct: 157 GRICLDILKDKWTAAYNIQTVLLSLQSLLGEPNNASPLNGEAAELWDKNPEEFQK 211 >UniRef50_O00762 Cluster: Ubiquitin-conjugating enzyme E2 C; n=26; Eukaryota|Rep: Ubiquitin-conjugating enzyme E2 C - Homo sapiens (Human) Length = 179 Score = 50.0 bits (114), Expect = 3e-05 Identities = 23/47 (48%), Positives = 31/47 (65%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYK 141 G+ICLDIL+ +WS + +LLSI SLL +PN D PL A ++K Sbjct: 111 GNICLDILKEKWSALYDVRTILLSIQSLLGEPNIDSPLNTHAAELWK 157 >UniRef50_A3C6U5 Cluster: Ubiquitin carrier protein; n=2; Oryza sativa|Rep: Ubiquitin carrier protein - Oryza sativa subsp. japonica (Rice) Length = 191 Score = 49.6 bits (113), Expect = 4e-05 Identities = 23/66 (34%), Positives = 36/66 (54%), Gaps = 2/66 (3%) Frame = +1 Query: 1 GSICLDILRAQ--WSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELAR 174 G++CL IL W PA+T+ ++L+ I LL PNP DP + I+ D+ +Y R Sbjct: 122 GTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTDGYHIFIQDKPEYKRRVR 181 Query: 175 EWTRKY 192 ++Y Sbjct: 182 VQAKQY 187 >UniRef50_Q7QVX4 Cluster: Ubiquitin carrier protein; n=1; Giardia lamblia ATCC 50803|Rep: Ubiquitin carrier protein - Giardia lamblia ATCC 50803 Length = 192 Score = 49.6 bits (113), Expect = 4e-05 Identities = 22/58 (37%), Positives = 34/58 (58%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELAR 174 GS+CL IL +W P++TI ++LL + LL +PN P E ++ + D YN+ R Sbjct: 95 GSVCLSILSYEWKPSITIKEILLGLQVLLDEPNLQSPAQHEAFQLRREDLTAYNKRIR 152 >UniRef50_A7ARW5 Cluster: Putative uncharacterized protein; n=1; Babesia bovis|Rep: Putative uncharacterized protein - Babesia bovis Length = 423 Score = 49.6 bits (113), Expect = 4e-05 Identities = 20/57 (35%), Positives = 34/57 (59%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELA 171 G++CL+I+R W P T+ L + +LL +P P +PL E A + ++ E+ EL+ Sbjct: 362 GAVCLNIVREDWRPVYTVGTAALGLLNLLVEPQPIEPLDAEAAELLVSNPERLRELS 418 >UniRef50_A2G420 Cluster: Ubiquitin carrier protein; n=1; Trichomonas vaginalis G3|Rep: Ubiquitin carrier protein - Trichomonas vaginalis G3 Length = 175 Score = 49.6 bits (113), Expect = 4e-05 Identities = 24/66 (36%), Positives = 36/66 (54%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELAREW 180 G+IC+ L + W+ + + +LLSI LL PNP L E R++ + E Y A+ Sbjct: 88 GAICVSTLSSDWTEDMGLDHLLLSIKCLLLQPNPSSALNEEAGRLFSENYEDYCSRAKLM 147 Query: 181 TRKYAM 198 T+ YAM Sbjct: 148 TQVYAM 153 >UniRef50_A0CCE4 Cluster: Chromosome undetermined scaffold_167, whole genome shotgun sequence; n=2; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_167, whole genome shotgun sequence - Paramecium tetraurelia Length = 175 Score = 49.6 bits (113), Expect = 4e-05 Identities = 24/66 (36%), Positives = 39/66 (59%), Gaps = 2/66 (3%) Frame = +1 Query: 1 GSICLDILRAQ--WSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELAR 174 G C+DIL + +SPA T ++L ++ L PNP P E+A+I++ D KY + + Sbjct: 98 GKTCIDILNDKIGYSPAKTCVEILKALEDFLYRPNPKSPTNAELAKIFEQDLPKYELMIK 157 Query: 175 EWTRKY 192 E+ +KY Sbjct: 158 EFVQKY 163 >UniRef50_A6RUK1 Cluster: Ubiquitin carrier protein; n=2; Sclerotiniaceae|Rep: Ubiquitin carrier protein - Botryotinia fuckeliana B05.10 Length = 185 Score = 49.6 bits (113), Expect = 4e-05 Identities = 21/58 (36%), Positives = 32/58 (55%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELAR 174 G ICL+ILR W P L + +++ + L +PN DPL E A +++RE + R Sbjct: 109 GKICLNILREDWKPVLNLQAIVIGLQFLFLEPNASDPLNKEAAEDLRSNREGFKRNVR 166 >UniRef50_Q7KNM2 Cluster: Ubiquitin carrier protein; n=39; Eukaryota|Rep: Ubiquitin carrier protein - Drosophila melanogaster (Fruit fly) Length = 159 Score = 49.2 bits (112), Expect = 6e-05 Identities = 26/67 (38%), Positives = 37/67 (55%), Gaps = 2/67 (2%) Frame = +1 Query: 1 GSICLDILRAQ--WSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELAR 174 G++CL +L + W PA+TI ++LL I LL +PN DP E IY +R +Y + R Sbjct: 90 GTVCLSLLDEEKDWRPAITIKQILLGIQDLLNEPNIKDPAQAEAYTIYCQNRLEYEKRVR 149 Query: 175 EWTRKYA 195 R A Sbjct: 150 AQARAMA 156 >UniRef50_Q1EB54 Cluster: Ubiquitin-conjugating enzyme; n=7; Pezizomycotina|Rep: Ubiquitin-conjugating enzyme - Coccidioides immitis Length = 169 Score = 49.2 bits (112), Expect = 6e-05 Identities = 24/63 (38%), Positives = 36/63 (57%), Gaps = 2/63 (3%) Frame = +1 Query: 1 GSICLDILRAQ-WSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKT-DREKYNELAR 174 G ICL +L ++ W+P T+S L +I LL DP P+ PL ++A + + D + L R Sbjct: 89 GEICLSLLTSEHWAPTYTLSSTLAAIHQLLSDPRPESPLNVDVAALLREGDLLGWESLVR 148 Query: 175 EWT 183 WT Sbjct: 149 YWT 151 >UniRef50_P56616 Cluster: Ubiquitin-conjugating enzyme E2 C; n=20; Eukaryota|Rep: Ubiquitin-conjugating enzyme E2 C - Xenopus laevis (African clawed frog) Length = 179 Score = 49.2 bits (112), Expect = 6e-05 Identities = 22/63 (34%), Positives = 37/63 (58%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELAREW 180 G+ICLDIL+ +WS + +LLS+ SLL +PN + PL P A +++ L ++ Sbjct: 111 GNICLDILKDKWSALYDVRTILLSLQSLLGEPNNESPLNPYAAELWQNQTAYKKHLHEQY 170 Query: 181 TRK 189 ++ Sbjct: 171 QKQ 173 >UniRef50_Q6C9W0 Cluster: NEDD8-conjugating enzyme UBC12; n=41; Eukaryota|Rep: NEDD8-conjugating enzyme UBC12 - Yarrowia lipolytica (Candida lipolytica) Length = 179 Score = 48.8 bits (111), Expect = 7e-05 Identities = 19/53 (35%), Positives = 33/53 (62%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKY 159 G++CL+ILR W P L+++ V++ + L +PN DPL + A +RE++ Sbjct: 103 GNVCLNILREDWKPVLSLNAVMIGLQYLFLEPNASDPLNKDAAHQMTANREEF 155 >UniRef50_UPI00006CB812 Cluster: Ubiquitin-conjugating enzyme family protein; n=2; Tetrahymena thermophila SB210|Rep: Ubiquitin-conjugating enzyme family protein - Tetrahymena thermophila SB210 Length = 901 Score = 48.4 bits (110), Expect = 1e-04 Identities = 22/67 (32%), Positives = 40/67 (59%), Gaps = 1/67 (1%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKT-DREKYNELARE 177 G ICL++++ +WSP T+ + ++ L+ +PN D PL + + ++ D + Y LAR Sbjct: 819 GEICLNVVKDEWSPYWTLEALCRAVQQLMSNPNADSPLNCDAGNLVRSGDMDGYLSLARV 878 Query: 178 WTRKYAM 198 T +YA+ Sbjct: 879 LTDEYAI 885 >UniRef50_UPI000049916F Cluster: ubiquitin-conjugating enzyme; n=1; Entamoeba histolytica HM-1:IMSS|Rep: ubiquitin-conjugating enzyme - Entamoeba histolytica HM-1:IMSS Length = 185 Score = 48.4 bits (110), Expect = 1e-04 Identities = 23/61 (37%), Positives = 32/61 (52%), Gaps = 2/61 (3%) Frame = +1 Query: 1 GSICLDILRAQ--WSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELAR 174 G +CL LR WSP T++ V+ + SL +PNPDDPL E K D ++ L Sbjct: 109 GHVCLSTLRLDKDWSPVSTLNHVVCGLLSLFLEPNPDDPLNTEAGETMKRDINEFVRLVN 168 Query: 175 E 177 + Sbjct: 169 K 169 >UniRef50_Q586X5 Cluster: Ubiquitin carrier protein; n=3; Trypanosoma|Rep: Ubiquitin carrier protein - Trypanosoma brucei Length = 251 Score = 48.4 bits (110), Expect = 1e-04 Identities = 22/66 (33%), Positives = 37/66 (56%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELAREW 180 G IC+++L+ W+P+L + VL + LL +PN + L E AR+ D + Y A Sbjct: 86 GDICVNVLKRDWNPSLGLRHVLTIVRCLLIEPNAESALNEEAARLLMEDYDAYRRKADMM 145 Query: 181 TRKYAM 198 T+ +A+ Sbjct: 146 TKVHAI 151 >UniRef50_Q247Y5 Cluster: Ubiquitin carrier protein; n=1; Tetrahymena thermophila SB210|Rep: Ubiquitin carrier protein - Tetrahymena thermophila SB210 Length = 186 Score = 48.4 bits (110), Expect = 1e-04 Identities = 18/43 (41%), Positives = 28/43 (65%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVLLSICSLLCDPNPDDPLVPEIA 129 G++CL+ILRA W P L + ++ + L +PNP+DPL + A Sbjct: 112 GNVCLNILRADWKPVLNLYNIISGVLFLFIEPNPNDPLNKQAA 154 >UniRef50_P62256 Cluster: Ubiquitin-conjugating enzyme E2 H; n=51; Eumetazoa|Rep: Ubiquitin-conjugating enzyme E2 H - Homo sapiens (Human) Length = 183 Score = 48.4 bits (110), Expect = 1e-04 Identities = 22/66 (33%), Positives = 37/66 (56%), Gaps = 1/66 (1%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVLLSIC-SLLCDPNPDDPLVPEIARIYKTDREKYNELARE 177 G++CLD++ W+ ++ + S LL PNP DPL + A +Y E+Y + +E Sbjct: 84 GTVCLDVINQTWTALYDLTNIFESFLPQLLAYPNPIDPLNGDAAAMYLHRPEEYKQKIKE 143 Query: 178 WTRKYA 195 + +KYA Sbjct: 144 YIQKYA 149 >UniRef50_Q95017 Cluster: SUMO-conjugating enzyme UBC9; n=7; Eukaryota|Rep: SUMO-conjugating enzyme UBC9 - Caenorhabditis elegans Length = 166 Score = 48.4 bits (110), Expect = 1e-04 Identities = 23/67 (34%), Positives = 39/67 (58%), Gaps = 2/67 (2%) Frame = +1 Query: 1 GSICLDIL--RAQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELAR 174 G++CL +L W P+++I ++L+ I LL PN +DP E +IY +R +Y + + Sbjct: 90 GTVCLSLLDENKDWKPSISIKQLLIGIQDLLNHPNIEDPAQAEAYQIYCQNRAEYEKRVK 149 Query: 175 EWTRKYA 195 + KYA Sbjct: 150 KEAVKYA 156 >UniRef50_A0D4V6 Cluster: Chromosome undetermined scaffold_38, whole genome shotgun sequence; n=2; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_38, whole genome shotgun sequence - Paramecium tetraurelia Length = 149 Score = 47.6 bits (108), Expect = 2e-04 Identities = 22/67 (32%), Positives = 36/67 (53%), Gaps = 2/67 (2%) Frame = +1 Query: 1 GSICLDILRA--QWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELAR 174 G C D++ QW P T+ +VL I +++ N + L + +YK+D+ K+ E R Sbjct: 82 GEFCEDMIETKDQWQPTKTVKQVLEKILNIMGQVNTEQALNQKAMELYKSDKGKFEEAVR 141 Query: 175 EWTRKYA 195 T+KYA Sbjct: 142 SETQKYA 148 >UniRef50_A0BIB5 Cluster: Chromosome undetermined scaffold_11, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_11, whole genome shotgun sequence - Paramecium tetraurelia Length = 204 Score = 47.6 bits (108), Expect = 2e-04 Identities = 25/49 (51%), Positives = 32/49 (65%), Gaps = 2/49 (4%) Frame = +1 Query: 7 ICLDILRAQWSPALTISKVLLSICSLLCDPNP--DDPLVPEIARIYKTD 147 ICLD+L+ +WSPAL I +LL I LL NP DDPL EI ++K + Sbjct: 82 ICLDVLKDKWSPALQIRSILLQIQVLLSYTNPSMDDPLNIEILCLWKAN 130 >UniRef50_Q4Q5L3 Cluster: Ubiquitin carrier protein; n=6; Trypanosomatidae|Rep: Ubiquitin carrier protein - Leishmania major Length = 234 Score = 47.2 bits (107), Expect = 2e-04 Identities = 22/66 (33%), Positives = 35/66 (53%), Gaps = 1/66 (1%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVL-LSICSLLCDPNPDDPLVPEIARIYKTDREKYNELARE 177 GS+CLD++ W+P + + + + LL PNP DPL + A + DR ++ L RE Sbjct: 86 GSVCLDVINQTWTPMYQLENIFDVFLPQLLRYPNPSDPLNVQAAHLLHADRVGFDALLRE 145 Query: 178 WTRKYA 195 +A Sbjct: 146 HVSTHA 151 >UniRef50_Q4DY64 Cluster: Ubiquitin-conjugating enzyme E2, putative; n=2; Trypanosoma|Rep: Ubiquitin-conjugating enzyme E2, putative - Trypanosoma cruzi Length = 199 Score = 47.2 bits (107), Expect = 2e-04 Identities = 21/63 (33%), Positives = 36/63 (57%), Gaps = 3/63 (4%) Frame = +1 Query: 7 ICLDILRAQWSPALTISKVLLSICSLLCDPNPDDPL---VPEIARIYKTDREKYNELARE 177 +CL + +W P +++ +++ I L DPNPDDPL + A++ K + K+ + AR Sbjct: 133 VCLSF-QTEWKPTMSLRDIIIMIELLFQDPNPDDPLHGTAKQAAQMMKDNPAKFRDKARR 191 Query: 178 WTR 186 W R Sbjct: 192 WMR 194 >UniRef50_Q6MYZ2 Cluster: Ubiquitin carrier protein; n=7; Trichocomaceae|Rep: Ubiquitin carrier protein - Aspergillus fumigatus (Sartorya fumigata) Length = 530 Score = 47.2 bits (107), Expect = 2e-04 Identities = 28/93 (30%), Positives = 44/93 (47%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELAREW 180 G++C+D L+ W LT+ VL++I LL PNPD L + + D + + A+ Sbjct: 189 GAVCVDTLKRDWKSTLTLKDVLVTISCLLIYPNPDSALNSTAGALLQEDYDAFARQAKLM 248 Query: 181 TRKYAM**VNCDINKTYTHTSPQPGLYPPTLVP 279 T +A V D+ + G P TL+P Sbjct: 249 TSIHAP--VPPDLRNAVVEAKSR-GEEPGTLIP 278 >UniRef50_Q5YES5 Cluster: Ubiquitin conjugating enzyme E2 2; n=1; Bigelowiella natans|Rep: Ubiquitin conjugating enzyme E2 2 - Bigelowiella natans (Pedinomonas minutissima) (Chlorarachnion sp.(strain CCMP 621)) Length = 154 Score = 46.8 bits (106), Expect = 3e-04 Identities = 20/65 (30%), Positives = 34/65 (52%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELAREW 180 G IC L+ WS ++ V+ I L+ +P+ D + E+A+ + D EK+ A +W Sbjct: 89 GQICFQGLKDTWSSSMNAKSVIQFIIDLINNPDCGDAINSEVAKCMQEDMEKFKSTAAKW 148 Query: 181 TRKYA 195 +YA Sbjct: 149 VEEYA 153 >UniRef50_Q16763 Cluster: Ubiquitin-conjugating enzyme E2 S; n=33; Eumetazoa|Rep: Ubiquitin-conjugating enzyme E2 S - Homo sapiens (Human) Length = 222 Score = 46.8 bits (106), Expect = 3e-04 Identities = 23/58 (39%), Positives = 33/58 (56%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELAR 174 G IC+++L+ W+ L I VLL+I LL PNP+ L E R+ + E+Y AR Sbjct: 92 GEICVNVLKRDWTAELGIRHVLLTIKCLLIHPNPESALNEEAGRLLLENYEEYAARAR 149 >UniRef50_O74549 Cluster: NEDD8-conjugating enzyme ubc12; n=10; Dikarya|Rep: NEDD8-conjugating enzyme ubc12 - Schizosaccharomyces pombe (Fission yeast) Length = 177 Score = 46.8 bits (106), Expect = 3e-04 Identities = 20/58 (34%), Positives = 32/58 (55%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELAR 174 G++CL+ILR W+P L ++ +L+ + L PN +DPL E A D + + R Sbjct: 102 GNVCLNILRQDWNPVLNLNSILVGLQFLFLSPNAEDPLNKEAAADLHKDPQGFASRVR 159 >UniRef50_UPI00006CC8BE Cluster: Ubiquitin-conjugating enzyme family protein; n=1; Tetrahymena thermophila SB210|Rep: Ubiquitin-conjugating enzyme family protein - Tetrahymena thermophila SB210 Length = 147 Score = 46.4 bits (105), Expect = 4e-04 Identities = 20/65 (30%), Positives = 38/65 (58%), Gaps = 1/65 (1%) Frame = +1 Query: 1 GSICLDIL-RAQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELARE 177 G +C ++L +W P + V+ I S+L +PN D + E A+ YK+D +++ + A+E Sbjct: 80 GEVCKEMLGEKEWVPTKQVKTVIEIIASMLAEPNVDSAINNEAAKQYKSDPKEFEKKAKE 139 Query: 178 WTRKY 192 + +Y Sbjct: 140 FINQY 144 >UniRef50_UPI00006064E0 Cluster: PREDICTED: similar to ubiquitin-conjugating enzyme E2D 4 (putative); n=1; Mus musculus|Rep: PREDICTED: similar to ubiquitin-conjugating enzyme E2D 4 (putative) - Mus musculus Length = 85 Score = 46.4 bits (105), Expect = 4e-04 Identities = 20/25 (80%), Positives = 23/25 (92%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVLLSI 75 GSICLDILR+QWSPALT+SK LL + Sbjct: 45 GSICLDILRSQWSPALTVSKGLLCL 69 >UniRef50_P60604 Cluster: Ubiquitin-conjugating enzyme E2 G2; n=80; Eukaryota|Rep: Ubiquitin-conjugating enzyme E2 G2 - Homo sapiens (Human) Length = 165 Score = 46.4 bits (105), Expect = 4e-04 Identities = 16/53 (30%), Positives = 37/53 (69%) Frame = +1 Query: 31 QWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELAREWTRK 189 +WSP ++ K+LLS+ S+L +PN + + +++++ DRE++ ++A++ +K Sbjct: 109 RWSPVQSVEKILLSVVSMLAEPNDESGANVDASKMWRDDREQFYKIAKQIVQK 161 >UniRef50_Q0R0E7 Cluster: Ubiquitin carrier protein; n=1; Symbiodinium sp. C3|Rep: Ubiquitin carrier protein - Symbiodinium sp. C3 Length = 167 Score = 46.0 bits (104), Expect = 5e-04 Identities = 24/58 (41%), Positives = 34/58 (58%), Gaps = 5/58 (8%) Frame = +1 Query: 1 GSICLDILRAQ-WSPALTISKVLLSICSLLCDPN----PDDPLVPEIARIYKTDREKY 159 G ICLD+L+ WSPA + +LL+I SLL DP+ P+ PE ++ DR+ Y Sbjct: 86 GQICLDLLKGSGWSPAYDVCTILLAIQSLLADPDTHATPEGGANPEAESLFVRDRQGY 143 >UniRef50_Q6CSW8 Cluster: NEDD8-conjugating enzyme UBC12; n=1; Kluyveromyces lactis|Rep: NEDD8-conjugating enzyme UBC12 - Kluyveromyces lactis (Yeast) (Candida sphaerica) Length = 184 Score = 46.0 bits (104), Expect = 5e-04 Identities = 18/44 (40%), Positives = 29/44 (65%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVLLSICSLLCDPNPDDPLVPEIAR 132 G++CL++LR W+PAL I +++ I L +PN DPL + A+ Sbjct: 109 GNVCLNLLREDWTPALDIQSIIIGILFLFHEPNGRDPLNKDAAK 152 >UniRef50_A2AX45 Cluster: Ubiquitin carrier protein; n=1; Guillardia theta|Rep: Ubiquitin carrier protein - Guillardia theta (Cryptomonas phi) Length = 256 Score = 45.6 bits (103), Expect = 7e-04 Identities = 21/65 (32%), Positives = 33/65 (50%), Gaps = 1/65 (1%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVL-LSICSLLCDPNPDDPLVPEIARIYKTDREKYNELARE 177 GS+CLD++ W P + + + + LL PNP DPL + A + D + Y+ R Sbjct: 148 GSVCLDVINQTWKPMFDLVNIFEVFLPQLLTYPNPSDPLNADAAALSMKDPQTYHSKIRM 207 Query: 178 WTRKY 192 + KY Sbjct: 208 FIDKY 212 >UniRef50_Q9N2W9 Cluster: Ubiquitin carrier protein; n=1; Caenorhabditis elegans|Rep: Ubiquitin carrier protein - Caenorhabditis elegans Length = 221 Score = 45.6 bits (103), Expect = 7e-04 Identities = 21/66 (31%), Positives = 35/66 (53%), Gaps = 1/66 (1%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVLLSIC-SLLCDPNPDDPLVPEIARIYKTDREKYNELARE 177 G++CLD++ W+ ++ + + LL PN DPL E AR+Y E+Y RE Sbjct: 85 GTVCLDVINQAWTALYDLTNIFDTFLPQLLTYPNAADPLNGEAARLYIHKPEEYRRTCRE 144 Query: 178 WTRKYA 195 + ++A Sbjct: 145 YVMRFA 150 >UniRef50_Q7QP58 Cluster: GLP_382_4762_5115; n=1; Giardia lamblia ATCC 50803|Rep: GLP_382_4762_5115 - Giardia lamblia ATCC 50803 Length = 117 Score = 45.6 bits (103), Expect = 7e-04 Identities = 23/63 (36%), Positives = 36/63 (57%) Frame = -3 Query: 195 GILPRPLTG*FIVLFSVCFIDPSNFWHQRVVWVGIA*K*AD*EQHFGYGERW*PLCTQNV 16 G++ R L V+ VC P + +RVVW+G+ K A+ +++ G GE W PL +NV Sbjct: 10 GVVKRILLDGPYVILLVCLQQPCSRRVERVVWIGVIEKAANGKKYLGDGEHWGPLFLENV 69 Query: 15 KTD 7 + D Sbjct: 70 QAD 72 >UniRef50_A0DYM1 Cluster: Chromosome undetermined scaffold_7, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_7, whole genome shotgun sequence - Paramecium tetraurelia Length = 1164 Score = 45.6 bits (103), Expect = 7e-04 Identities = 24/65 (36%), Positives = 33/65 (50%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELAREW 180 G IC IL ++P + ++ ++ LL P PDDPL IA Y D + Y E A Sbjct: 1056 GRICHSILGRNYTPDTKVIQIFEAVYGLLMTPEPDDPLDTTIASEYMQDLKLYLEKATNH 1115 Query: 181 TRKYA 195 T K+A Sbjct: 1116 TLKFA 1120 >UniRef50_Q0JAS6 Cluster: Os04g0580400 protein; n=1; Oryza sativa (japonica cultivar-group)|Rep: Os04g0580400 protein - Oryza sativa subsp. japonica (Rice) Length = 139 Score = 45.2 bits (102), Expect = 0.001 Identities = 19/54 (35%), Positives = 30/54 (55%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYN 162 G++CL IL W P++T+ ++L+ I L DPNP+ +Y+T R N Sbjct: 58 GAVCLSILSTAWKPSITVRQILIGIQELFDDPNPNSAAQNISYELYRTWRSTGN 111 >UniRef50_Q4Q3Q8 Cluster: Ubiquitin carrier protein; n=4; Leishmania|Rep: Ubiquitin carrier protein - Leishmania major Length = 243 Score = 45.2 bits (102), Expect = 0.001 Identities = 21/61 (34%), Positives = 32/61 (52%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELAREW 180 G IC++ L+ WSP L + +L+ I LL +PNP+ L E R+ + Y A + Sbjct: 86 GDICVNTLKRDWSPMLGLRHILVVIRCLLIEPNPESALNEEAGRLILEEYAAYERKAAMY 145 Query: 181 T 183 T Sbjct: 146 T 146 >UniRef50_A4QTE5 Cluster: Predicted protein; n=1; Magnaporthe grisea|Rep: Predicted protein - Magnaporthe grisea (Rice blast fungus) (Pyricularia grisea) Length = 465 Score = 45.2 bits (102), Expect = 0.001 Identities = 20/49 (40%), Positives = 31/49 (63%) Frame = +1 Query: 49 TISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELAREWTRKYA 195 ++ +L +IC L P+ DDPL+ EIA +Y D ++Y +A +T KYA Sbjct: 353 SLGALLTAICVFLASPDVDDPLLIEIAELYVRDCDRYEVVAWNYTCKYA 401 >UniRef50_Q9VZ73 Cluster: CG17030-PA; n=1; Drosophila melanogaster|Rep: CG17030-PA - Drosophila melanogaster (Fruit fly) Length = 180 Score = 44.8 bits (101), Expect = 0.001 Identities = 20/66 (30%), Positives = 37/66 (56%), Gaps = 1/66 (1%) Frame = +1 Query: 1 GSICLDILRAQ-WSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELARE 177 G +C+ IL + W P I +VL + + + DP P++ E+A Y+ D ++ ++A Sbjct: 92 GQVCVPILEVEHWIPTTRIDQVLQVLLATINDPQPENAWHIEMAGEYRNDPVRFFKMADA 151 Query: 178 WTRKYA 195 W +KY+ Sbjct: 152 WVQKYS 157 >UniRef50_Q5A339 Cluster: Ubiquitin carrier protein; n=2; Eukaryota|Rep: Ubiquitin carrier protein - Candida albicans (Yeast) Length = 219 Score = 44.8 bits (101), Expect = 0.001 Identities = 21/66 (31%), Positives = 35/66 (53%), Gaps = 2/66 (3%) Frame = +1 Query: 1 GSICLDILRAQ--WSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELAR 174 G++CL IL W PA+T++++LL + LL PN + P + R + D Y + + Sbjct: 150 GTVCLSILNESQDWKPAITLTQILLGVQELLDTPNKESPAQEDAYRHFVHDMNTYVKRVK 209 Query: 175 EWTRKY 192 +KY Sbjct: 210 AEVKKY 215 >UniRef50_Q4PA94 Cluster: Ubiquitin carrier protein; n=11; Eukaryota|Rep: Ubiquitin carrier protein - Ustilago maydis (Smut fungus) Length = 372 Score = 44.8 bits (101), Expect = 0.001 Identities = 20/66 (30%), Positives = 35/66 (53%), Gaps = 1/66 (1%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVL-LSICSLLCDPNPDDPLVPEIARIYKTDREKYNELARE 177 GS+CLD++ WSP + + + LL PNP DPL E A + + + Y ++ Sbjct: 268 GSVCLDVINQTWSPMFDCINIFEVFLPQLLRYPNPTDPLNGEAAALLMREPKTYEARVKD 327 Query: 178 WTRKYA 195 + +++A Sbjct: 328 YVQRFA 333 >UniRef50_A4RG25 Cluster: Putative uncharacterized protein; n=4; Sordariomycetes|Rep: Putative uncharacterized protein - Magnaporthe grisea (Rice blast fungus) (Pyricularia grisea) Length = 166 Score = 44.8 bits (101), Expect = 0.001 Identities = 16/47 (34%), Positives = 30/47 (63%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYK 141 G +CLD+L+ W+PA ++ + + ++ LL P PD PL ++A + + Sbjct: 95 GEVCLDLLKEAWTPAYSVLETVRAVRLLLATPEPDSPLNVDVAALVR 141 >UniRef50_P27949 Cluster: Ubiquitin-conjugating enzyme E2-21 kDa; n=2; African swine fever virus|Rep: Ubiquitin-conjugating enzyme E2-21 kDa - African swine fever virus (strain BA71V) (ASFV) Length = 215 Score = 44.8 bits (101), Expect = 0.001 Identities = 27/76 (35%), Positives = 38/76 (50%), Gaps = 13/76 (17%) Frame = +1 Query: 1 GSICLDILRAQ--------WSPALTISKVLLSICSLLCDPNPDDPLVPEIAR-----IYK 141 G +C+ IL WSPA I +LLS+ SLL +PNPD P + A+ +YK Sbjct: 82 GRLCISILHGDNAEEQGMTWSPAQKIDTILLSVISLLNEPNPDSPANVDAAKSYRKYVYK 141 Query: 142 TDREKYNELAREWTRK 189 D E Y ++ +K Sbjct: 142 EDLESYPMEVKKTVKK 157 >UniRef50_Q75AF2 Cluster: NEDD8-conjugating enzyme UBC12; n=2; Eremothecium gossypii|Rep: NEDD8-conjugating enzyme UBC12 - Ashbya gossypii (Yeast) (Eremothecium gossypii) Length = 184 Score = 44.8 bits (101), Expect = 0.001 Identities = 17/38 (44%), Positives = 25/38 (65%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVLLSICSLLCDPNPDDPL 114 G+ICL++LR WSP + + V+L + L +PN DPL Sbjct: 109 GNICLNVLREDWSPVMDLQTVVLGLLFLFLEPNGSDPL 146 >UniRef50_A3AAU2 Cluster: Putative uncharacterized protein; n=3; Oryza sativa|Rep: Putative uncharacterized protein - Oryza sativa subsp. japonica (Rice) Length = 310 Score = 44.4 bits (100), Expect = 0.002 Identities = 24/65 (36%), Positives = 36/65 (55%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELAREW 180 G++ LD WS A + +L+ S+L DP D P+ +IA Y D E+Y AR W Sbjct: 132 GNMVLDA--ESWSCATKLRGLLIGFVSVLYDPLLDYPINYDIAEQYAYDYERYEAEARAW 189 Query: 181 TRKYA 195 TR+++ Sbjct: 190 TREFS 194 >UniRef50_Q18288 Cluster: Ubiquitin conjugating enzyme protein 23; n=1; Caenorhabditis elegans|Rep: Ubiquitin conjugating enzyme protein 23 - Caenorhabditis elegans Length = 546 Score = 44.4 bits (100), Expect = 0.002 Identities = 23/66 (34%), Positives = 38/66 (57%), Gaps = 1/66 (1%) Frame = +1 Query: 1 GSICL-DILRAQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELARE 177 G+ICL D+ W ++TI KVL+ I S + + N +P+ EI +RE + + A Sbjct: 431 GTICLHDVDNGVWPVSMTIYKVLIVIQSWMSNFNEKEPIDVEILEQATNNREVFEKTAEF 490 Query: 178 WTRKYA 195 WT+++A Sbjct: 491 WTKRFA 496 >UniRef50_A4GFM0 Cluster: Peroxin 4; n=1; Penicillium chrysogenum|Rep: Peroxin 4 - Penicillium chrysogenum (Penicillium notatum) Length = 164 Score = 44.4 bits (100), Expect = 0.002 Identities = 23/64 (35%), Positives = 34/64 (53%), Gaps = 1/64 (1%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKT-DREKYNELARE 177 G IC L W P + +S +L +I LL P+PD PL P+IA + + D + + R Sbjct: 94 GEICSS-LNNDWKPTVNLSGILAAIQLLLTVPDPDSPLNPDIAVLMRNGDLAGWESVVRY 152 Query: 178 WTRK 189 WT + Sbjct: 153 WTEE 156 >UniRef50_A3FQP7 Cluster: Ubiquitin carrier protein; n=2; Cryptosporidium|Rep: Ubiquitin carrier protein - Cryptosporidium parvum Iowa II Length = 190 Score = 44.0 bits (99), Expect = 0.002 Identities = 17/58 (29%), Positives = 34/58 (58%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELAR 174 G +C++I+R W P LTIS V+ + +LL +P+ DP + +++++ + + R Sbjct: 130 GHVCINIIREDWKPTLTISIVICGLLNLLIEPSNSDPFNEFASILFESNLSLFKSINR 187 >UniRef50_Q8SSK8 Cluster: UBIQUITIN CONJUGATING ENZYME E2; n=1; Encephalitozoon cuniculi|Rep: UBIQUITIN CONJUGATING ENZYME E2 - Encephalitozoon cuniculi Length = 204 Score = 44.0 bits (99), Expect = 0.002 Identities = 22/62 (35%), Positives = 31/62 (50%) Frame = +1 Query: 7 ICLDILRAQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELAREWTR 186 +CLDI+ +W P+L I VL I LL PN P + + + D Y E RE + Sbjct: 134 VCLDIIGDRWKPSLNIMNVLCGIQQLLGSPNTRSPANTDASGCLRRDPAGYLESVRENIK 193 Query: 187 KY 192 +Y Sbjct: 194 RY 195 >UniRef50_Q5BE71 Cluster: Ubiquitin carrier protein; n=2; Trichocomaceae|Rep: Ubiquitin carrier protein - Emericella nidulans (Aspergillus nidulans) Length = 488 Score = 44.0 bits (99), Expect = 0.002 Identities = 21/59 (35%), Positives = 32/59 (54%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELARE 177 G++C+D L+ W LT+ VL++I LL PNPD L + +E Y+ AR+ Sbjct: 128 GAVCVDTLKRDWKSTLTLKDVLITISCLLIFPNPDSALNATAGALL---QENYDAFARQ 183 >UniRef50_Q55U75 Cluster: Ubiquitin carrier protein; n=2; Filobasidiella neoformans|Rep: Ubiquitin carrier protein - Cryptococcus neoformans (Filobasidiella neoformans) Length = 246 Score = 44.0 bits (99), Expect = 0.002 Identities = 23/66 (34%), Positives = 34/66 (51%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELAREW 180 G IC+D L+ W + VL++I LL PNP+ L E + D E Y++ AR Sbjct: 87 GEICVDTLKKGWKKEYGVGHVLITIKCLLIFPNPESALDEEAGKQLLEDYEGYSKYARLM 146 Query: 181 TRKYAM 198 T +A+ Sbjct: 147 TSIHAI 152 >UniRef50_UPI00015565E9 Cluster: PREDICTED: similar to ubiquitin-conjugating enzyme UbcH7; n=1; Ornithorhynchus anatinus|Rep: PREDICTED: similar to ubiquitin-conjugating enzyme UbcH7 - Ornithorhynchus anatinus Length = 270 Score = 43.6 bits (98), Expect = 0.003 Identities = 19/51 (37%), Positives = 32/51 (62%) Frame = +1 Query: 40 PALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELAREWTRKY 192 P + V+ S+ +L+ DP P+ PL ++A Y DR+K+ + A E+T+KY Sbjct: 213 PCVLSPTVIQSLIALVNDPQPEHPLRADLAEEYSKDRKKFCKNAEEFTKKY 263 >UniRef50_Q9AW53 Cluster: Ubiquitin carrier protein; n=1; Guillardia theta|Rep: Ubiquitin carrier protein - Guillardia theta (Cryptomonas phi) Length = 144 Score = 43.6 bits (98), Expect = 0.003 Identities = 20/38 (52%), Positives = 25/38 (65%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVLLSICSLLCDPNPDDPL 114 G ICLDIL+ QW+PA TI +I LL +P P+ PL Sbjct: 84 GEICLDILKNQWTPAWTILFSCQAIIVLLTNPEPNSPL 121 >UniRef50_Q0DY15 Cluster: Os02g0721200 protein; n=2; Oryza sativa (japonica cultivar-group)|Rep: Os02g0721200 protein - Oryza sativa subsp. japonica (Rice) Length = 231 Score = 43.6 bits (98), Expect = 0.003 Identities = 20/44 (45%), Positives = 28/44 (63%) Frame = +1 Query: 64 LLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELAREWTRKYA 195 LL S+L DP D P+ +IA Y+ + E Y + AREWTR+Y+ Sbjct: 145 LLGFVSILYDPLLDYPINDDIAEQYENEYELYEKEAREWTRRYS 188 >UniRef50_A2EJF5 Cluster: Ubiquitin-conjugating enzyme family protein; n=1; Trichomonas vaginalis G3|Rep: Ubiquitin-conjugating enzyme family protein - Trichomonas vaginalis G3 Length = 162 Score = 43.2 bits (97), Expect = 0.004 Identities = 19/64 (29%), Positives = 33/64 (51%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELAREW 180 G +CL IL W P++ + ++L+ I LL +PNP+ P Y +R Y+ +E Sbjct: 93 GKVCLSILTDGWKPSINLRQILVGIQKLLIEPNPESPAHQVNYDNYMMNRPLYDANIKEC 152 Query: 181 TRKY 192 + + Sbjct: 153 AKMH 156 >UniRef50_A2EFK5 Cluster: Ubiquitin carrier protein; n=1; Trichomonas vaginalis G3|Rep: Ubiquitin carrier protein - Trichomonas vaginalis G3 Length = 160 Score = 43.2 bits (97), Expect = 0.004 Identities = 18/53 (33%), Positives = 34/53 (64%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKY 159 G+IC++ +R + P ++ +++ + L DPNPDD L E A++ K+D E++ Sbjct: 89 GTICINAIRGGYFPGQSLVQIIEEVKMALKDPNPDDYLNREAAQLMKSDIEQF 141 >UniRef50_A0BMS1 Cluster: Chromosome undetermined scaffold_117, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_117, whole genome shotgun sequence - Paramecium tetraurelia Length = 1189 Score = 43.2 bits (97), Expect = 0.004 Identities = 22/65 (33%), Positives = 36/65 (55%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELAREW 180 G IC IL ++ T+ ++ +I LL P PDDPL IA Y + ++Y A+ + Sbjct: 1073 GRICHSILDRNYTLDTTVLQIFQAIFGLLMTPEPDDPLDTTIASEYLENLQQYQIKAKAF 1132 Query: 181 TRKYA 195 T+++A Sbjct: 1133 TQEHA 1137 >UniRef50_A2EGV7 Cluster: Ubiquitin carrier protein; n=1; Trichomonas vaginalis G3|Rep: Ubiquitin carrier protein - Trichomonas vaginalis G3 Length = 175 Score = 42.7 bits (96), Expect = 0.005 Identities = 22/60 (36%), Positives = 36/60 (60%), Gaps = 7/60 (11%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVLLSICSLLCDPNPDDPLVPEIAR-------IYKTDREKY 159 GS+CL ILR ++P ++I ++ I L +P P+DPL E A+ ++KT+ +KY Sbjct: 93 GSVCLSILREAYNPTVSIPFLIAGIQYLFTEPEPNDPLNKEAAQQMINDFALFKTNVDKY 152 >UniRef50_A7TP75 Cluster: Putative uncharacterized protein; n=1; Vanderwaltozyma polyspora DSM 70294|Rep: Putative uncharacterized protein - Vanderwaltozyma polyspora DSM 70294 Length = 157 Score = 42.7 bits (96), Expect = 0.005 Identities = 22/48 (45%), Positives = 29/48 (60%), Gaps = 1/48 (2%) Frame = +1 Query: 1 GSICLDIL-RAQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYK 141 G ICL+IL A WSP + V+L+I LL DP D PL +++ I K Sbjct: 89 GKICLNILDNANWSPVWNLLTVVLAIYQLLSDPVTDSPLNIDLSNILK 136 >UniRef50_Q0JI74 Cluster: Ubiquitin carrier protein; n=2; Oryza sativa (japonica cultivar-group)|Rep: Ubiquitin carrier protein - Oryza sativa subsp. japonica (Rice) Length = 368 Score = 42.3 bits (95), Expect = 0.006 Identities = 18/20 (90%), Positives = 19/20 (95%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISK 60 GSICLDIL+ QWSPALTISK Sbjct: 183 GSICLDILKEQWSPALTISK 202 >UniRef50_Q5DI37 Cluster: Ubiquitin carrier protein; n=2; Schistosoma japonicum|Rep: Ubiquitin carrier protein - Schistosoma japonicum (Blood fluke) Length = 203 Score = 42.3 bits (95), Expect = 0.006 Identities = 20/65 (30%), Positives = 34/65 (52%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELAREW 180 G +C++ L+ W L + +LL+I LL +PNP+ L E ++ D ++ AR Sbjct: 89 GEVCVNTLKKDWKSNLGLRHILLTIRCLLIEPNPESALNEEAGKLLLEDYNEFVSEARLL 148 Query: 181 TRKYA 195 T +A Sbjct: 149 TEVHA 153 >UniRef50_A2E403 Cluster: Ubiquitin carrier protein; n=1; Trichomonas vaginalis G3|Rep: Ubiquitin carrier protein - Trichomonas vaginalis G3 Length = 155 Score = 41.9 bits (94), Expect = 0.009 Identities = 18/64 (28%), Positives = 34/64 (53%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELAREW 180 G+ICL+I++ ++P +TI +++ I + PNP PL A + D + E E+ Sbjct: 88 GNICLNIIKGDYNPTITILQIIQGIELIFVTPNPYSPLNNAAAEMLIHDESGFREKVEEY 147 Query: 181 TRKY 192 ++ Sbjct: 148 MEEF 151 >UniRef50_A0EBF3 Cluster: Ubiquitin carrier protein; n=1; Paramecium tetraurelia|Rep: Ubiquitin carrier protein - Paramecium tetraurelia Length = 185 Score = 41.9 bits (94), Expect = 0.009 Identities = 18/59 (30%), Positives = 32/59 (54%), Gaps = 1/59 (1%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVLLSICSLLCD-PNPDDPLVPEIARIYKTDREKYNELAR 174 G +CL+ILR W P ++ V+ + L NP DPL E A + D++++ ++ + Sbjct: 110 GKVCLNILREDWRPVSSLKDVIFGLQMLFTQLTNPTDPLNKEAAELMLKDQQQFAQVVK 168 >UniRef50_A2QG50 Cluster: Ubiquitin carrier protein; n=1; Aspergillus niger|Rep: Ubiquitin carrier protein - Aspergillus niger Length = 185 Score = 41.9 bits (94), Expect = 0.009 Identities = 26/73 (35%), Positives = 39/73 (53%), Gaps = 8/73 (10%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVLLSICSLLCDPN---PDDPLV-----PEIARIYKTDREK 156 G +CL+IL+ +WS AL++ VLLSI ++L DP V E ++ + Sbjct: 113 GEVCLNILQDEWSQALSVRTVLLSISAMLGDPGMAVEGGNAVYGFANVEAGSMWMGNPGV 172 Query: 157 YNELAREWTRKYA 195 + AR+WTR YA Sbjct: 173 FEMAARDWTRMYA 185 >UniRef50_Q98S78 Cluster: Ubiquitin-conjugating enzyme E2-17 KD subunit; n=1; Guillardia theta|Rep: Ubiquitin-conjugating enzyme E2-17 KD subunit - Guillardia theta (Cryptomonas phi) Length = 147 Score = 41.5 bits (93), Expect = 0.011 Identities = 19/55 (34%), Positives = 30/55 (54%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNE 165 G +C+DIL +WSP + +LLS+ LL PN D P ++ ++ YN+ Sbjct: 86 GKVCIDILNKKWSPVYSNITLLLSLKILLEFPNSDSPANLRATNLFIRKKKLYNK 140 >UniRef50_Q4UI29 Cluster: Ubiquitin-conjugating enzyme E2 (RUB1 homologue), putative; n=2; Theileria|Rep: Ubiquitin-conjugating enzyme E2 (RUB1 homologue), putative - Theileria annulata Length = 249 Score = 41.5 bits (93), Expect = 0.011 Identities = 17/49 (34%), Positives = 29/49 (59%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTD 147 G++CL+ILR W P TI ++ + +LL +P ++PL A + + D Sbjct: 186 GAVCLNILREDWLPIYTIDTAIIGLVNLLIEPQFENPLDKFAANLLQKD 234 >UniRef50_Q0TZE7 Cluster: Ubiquitin carrier protein; n=1; Phaeosphaeria nodorum|Rep: Ubiquitin carrier protein - Phaeosphaeria nodorum (Septoria nodorum) Length = 465 Score = 41.5 bits (93), Expect = 0.011 Identities = 20/65 (30%), Positives = 34/65 (52%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELAREW 180 G++C++ L+ WS AL + VL++I LL PNP L ++ D + + A+ Sbjct: 127 GAVCVETLKRDWSSALKLRDVLVTISCLLIQPNPASALNEAAGKLASEDWDGFCRRAKLM 186 Query: 181 TRKYA 195 T +A Sbjct: 187 TEIHA 191 >UniRef50_Q5UQ40 Cluster: Putative uncharacterized protein; n=1; Acanthamoeba polyphaga mimivirus|Rep: Putative uncharacterized protein - Mimivirus Length = 1297 Score = 41.1 bits (92), Expect = 0.015 Identities = 21/66 (31%), Positives = 34/66 (51%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELAREW 180 G +C IL ++P + IS +L I LL +P+ +DPL +A IY Y ++ Sbjct: 1214 GRVCHSILDRNYTPNVKISLILQCIYGLLLNPDVNDPLDTNLAMIYYDANGLYEAQIIDY 1273 Query: 181 TRKYAM 198 K+A+ Sbjct: 1274 VNKFAL 1279 >UniRef50_Q7QQ94 Cluster: Ubiquitin carrier protein; n=1; Giardia lamblia ATCC 50803|Rep: Ubiquitin carrier protein - Giardia lamblia ATCC 50803 Length = 164 Score = 41.1 bits (92), Expect = 0.015 Identities = 17/45 (37%), Positives = 26/45 (57%) Frame = +1 Query: 31 QWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNE 165 +W P T+S ++LS+ SLL DPN P + A++Y D Y + Sbjct: 108 RWLPVHTVSSIILSVISLLSDPNCKSPANVDAAKLYTDDYPMYKK 152 >UniRef50_A7TL65 Cluster: Putative uncharacterized protein; n=1; Vanderwaltozyma polyspora DSM 70294|Rep: Putative uncharacterized protein - Vanderwaltozyma polyspora DSM 70294 Length = 323 Score = 41.1 bits (92), Expect = 0.015 Identities = 23/56 (41%), Positives = 31/56 (55%), Gaps = 1/56 (1%) Frame = +1 Query: 1 GSICLDILRAQ-WSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNE 165 G D L A+ WSP T+ VL+SI SLL DPN P + A Y+ + E+Y + Sbjct: 103 GDPMTDELDAETWSPVQTVESVLISIVSLLEDPNISSPANVDAAVDYRKNPEQYKQ 158 >UniRef50_P14682 Cluster: Ubiquitin-conjugating enzyme E2-34 kDa; n=14; Ascomycota|Rep: Ubiquitin-conjugating enzyme E2-34 kDa - Saccharomyces cerevisiae (Baker's yeast) Length = 295 Score = 41.1 bits (92), Expect = 0.015 Identities = 19/44 (43%), Positives = 27/44 (61%) Frame = +1 Query: 34 WSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNE 165 WSP T+ VL+SI SLL DPN + P + A Y+ + E+Y + Sbjct: 115 WSPVQTVESVLISIVSLLEDPNINSPANVDAAVDYRKNPEQYKQ 158 >UniRef50_UPI00001628C0 Cluster: UBC7 (ubiquitin-conjugating enzyme 7); ubiquitin-protein ligase; n=1; Arabidopsis thaliana|Rep: UBC7 (ubiquitin-conjugating enzyme 7); ubiquitin-protein ligase - Arabidopsis thaliana Length = 198 Score = 40.7 bits (91), Expect = 0.020 Identities = 16/58 (27%), Positives = 32/58 (55%) Frame = +1 Query: 16 DILRAQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELAREWTRK 189 ++ +W+P T+ ++LSI S+L PN + P E A+ ++ R+++ + RK Sbjct: 136 ELASERWTPVHTVESIMLSIISMLSGPNDESPANVEAAKEWRDKRDEFKKKVSRCVRK 193 >UniRef50_P42743 Cluster: Ubiquitin-conjugating enzyme E2-18 kDa; n=19; Spermatophyta|Rep: Ubiquitin-conjugating enzyme E2-18 kDa - Arabidopsis thaliana (Mouse-ear cress) Length = 161 Score = 40.7 bits (91), Expect = 0.020 Identities = 17/29 (58%), Positives = 22/29 (75%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVLLSICSLL 87 G ICLDIL WSPA+T++ V +SI S+L Sbjct: 96 GHICLDILYDSWSPAMTVNSVCISILSML 124 >UniRef50_Q9FF66 Cluster: Ubiquitin carrier protein; n=8; Viridiplantae|Rep: Ubiquitin carrier protein - Arabidopsis thaliana (Mouse-ear cress) Length = 251 Score = 39.9 bits (89), Expect = 0.035 Identities = 19/65 (29%), Positives = 36/65 (55%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELAREW 180 G IC++ L+ W+P+L + VL + LL +P P+ L + ++ + ++Y AR + Sbjct: 91 GEICVNTLKKDWNPSLGLRHVLSVVRCLLIEPFPESALNEQAGKMLLENYDEYARHARLY 150 Query: 181 TRKYA 195 T +A Sbjct: 151 TGIHA 155 >UniRef50_A2DRC1 Cluster: Ubiquitin carrier protein; n=1; Trichomonas vaginalis G3|Rep: Ubiquitin carrier protein - Trichomonas vaginalis G3 Length = 138 Score = 39.9 bits (89), Expect = 0.035 Identities = 15/56 (26%), Positives = 33/56 (58%) Frame = +1 Query: 22 LRAQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELAREWTRK 189 L +W P TI +++S+ +L DPNP PL + R++ +++++ + R++ + Sbjct: 75 LNEKWLPVHTIETIVISVICMLGDPNPQSPLNVKANRVFIQNKDEFWKTFRDYCNR 130 >UniRef50_Q8IH42 Cluster: Ubiquitin carrier protein; n=15; Fungi/Metazoa group|Rep: Ubiquitin carrier protein - Drosophila melanogaster (Fruit fly) Length = 180 Score = 39.5 bits (88), Expect = 0.046 Identities = 20/52 (38%), Positives = 29/52 (55%) Frame = +1 Query: 31 QWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELAREWTR 186 +W P T+ +LLS+ S+L DPN + + A+ Y RE Y E R+ TR Sbjct: 122 RWLPVHTVETILLSVISMLTDPNDESAANVDAAKEY---RENYAEFKRKVTR 170 >UniRef50_A7RLE1 Cluster: Predicted protein; n=1; Nematostella vectensis|Rep: Predicted protein - Nematostella vectensis Length = 178 Score = 39.5 bits (88), Expect = 0.046 Identities = 20/61 (32%), Positives = 29/61 (47%), Gaps = 2/61 (3%) Frame = +1 Query: 1 GSICLDIL--RAQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELAR 174 G++CL ++ W P +T +VL I LL DPN +P E IY R Y + Sbjct: 97 GTVCLSLIDKNKDWKPQVTAQQVLTGIQLLLADPNFQEPAQAEAFVIYTQSRLDYENKVK 156 Query: 175 E 177 + Sbjct: 157 Q 157 >UniRef50_Q7SGR9 Cluster: Ubiquitin carrier protein; n=11; Pezizomycotina|Rep: Ubiquitin carrier protein - Neurospora crassa Length = 212 Score = 39.5 bits (88), Expect = 0.046 Identities = 18/33 (54%), Positives = 23/33 (69%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVLLSICSLLCDPN 99 G ICLDIL+ +W+ A VLLS+ SLL +PN Sbjct: 179 GRICLDILKDKWTAAYNTQTVLLSLQSLLGEPN 211 >UniRef50_A6SCL8 Cluster: Putative uncharacterized protein; n=1; Botryotinia fuckeliana B05.10|Rep: Putative uncharacterized protein - Botryotinia fuckeliana B05.10 Length = 681 Score = 39.5 bits (88), Expect = 0.046 Identities = 22/61 (36%), Positives = 33/61 (54%) Frame = +1 Query: 13 LDILRAQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELAREWTRKY 192 L + +W ++ +VL SI S+L P DD +PEIA+ Y D + + E A T K+ Sbjct: 181 LPSIAVEWPLKKSLHEVLSSIFSILSKPELDDHFIPEIAKEYIDDYKGFFEKATISTSKH 240 Query: 193 A 195 A Sbjct: 241 A 241 >UniRef50_Q969M7 Cluster: NEDD8-conjugating enzyme UBE2F; n=34; Eumetazoa|Rep: NEDD8-conjugating enzyme UBE2F - Homo sapiens (Human) Length = 185 Score = 39.5 bits (88), Expect = 0.046 Identities = 24/72 (33%), Positives = 36/72 (50%), Gaps = 7/72 (9%) Frame = +1 Query: 1 GSICLDILRAQ------WSPALTISKVLLSICSLLCDP-NPDDPLVPEIARIYKTDREKY 159 G ICL +LR W+P T+ V+ + SL D N DDPL E A + D+E + Sbjct: 113 GEICLSLLREHSIDGTGWAPTRTLKDVVWGLNSLFTDLLNFDDPLNIEAAEHHLRDKEDF 172 Query: 160 NELAREWTRKYA 195 ++ ++YA Sbjct: 173 RNKVDDYIKRYA 184 >UniRef50_UPI0000498382 Cluster: ubiquitin-conjugating enzyme; n=1; Entamoeba histolytica HM-1:IMSS|Rep: ubiquitin-conjugating enzyme - Entamoeba histolytica HM-1:IMSS Length = 152 Score = 39.1 bits (87), Expect = 0.060 Identities = 17/54 (31%), Positives = 32/54 (59%) Frame = +1 Query: 34 WSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELAREWTRKYA 195 W+P ++ +VL++ S+L + D E+A++ E++ + AREWT+ YA Sbjct: 98 WAPTSSVYEVLVAFRSMLGSLSTDHVSDTEVAQVLAERPEEFKKTAREWTKLYA 151 >UniRef50_Q7R2Z1 Cluster: Ubiquitin carrier protein; n=1; Giardia lamblia ATCC 50803|Rep: Ubiquitin carrier protein - Giardia lamblia ATCC 50803 Length = 158 Score = 39.1 bits (87), Expect = 0.060 Identities = 19/48 (39%), Positives = 28/48 (58%), Gaps = 1/48 (2%) Frame = +1 Query: 1 GSICLDIL-RAQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYK 141 G ICL+IL + WSPA+++ + SI L PN D PL + + + K Sbjct: 88 GEICLNILTKDDWSPAISLISLAQSIAGLCSAPNTDSPLNCDASNLVK 135 >UniRef50_Q28XJ5 Cluster: GA20189-PA; n=1; Drosophila pseudoobscura|Rep: GA20189-PA - Drosophila pseudoobscura (Fruit fly) Length = 240 Score = 39.1 bits (87), Expect = 0.060 Identities = 17/29 (58%), Positives = 20/29 (68%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVLLSICSLL 87 G ICL IL WSPAL++ V LSI S+L Sbjct: 130 GHICLSILTEDWSPALSVQSVCLSIASML 158 >UniRef50_Q54J27 Cluster: Ubiquitin carrier protein; n=6; Eukaryota|Rep: Ubiquitin carrier protein - Dictyostelium discoideum AX4 Length = 517 Score = 38.7 bits (86), Expect = 0.080 Identities = 14/45 (31%), Positives = 29/45 (64%) Frame = +1 Query: 31 QWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNE 165 +W P +++ ++LS+ S+L DPN P + + ++TD+E+Y + Sbjct: 128 RWLPTQSVTTIILSLMSILSDPNCSSPANVDASVEWRTDKEQYKK 172 >UniRef50_Q96B02 Cluster: Probable ubiquitin-conjugating enzyme E2 W; n=50; Eukaryota|Rep: Probable ubiquitin-conjugating enzyme E2 W - Homo sapiens (Human) Length = 151 Score = 38.7 bits (86), Expect = 0.080 Identities = 17/29 (58%), Positives = 20/29 (68%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVLLSICSLL 87 G ICL IL WSPAL++ V LSI S+L Sbjct: 88 GHICLSILTEDWSPALSVQSVCLSIISML 116 >UniRef50_UPI00015B5920 Cluster: PREDICTED: similar to ubiquitin-conjugating enzyme h isoform 2; n=2; Endopterygota|Rep: PREDICTED: similar to ubiquitin-conjugating enzyme h isoform 2 - Nasonia vitripennis Length = 156 Score = 38.3 bits (85), Expect = 0.11 Identities = 20/54 (37%), Positives = 30/54 (55%), Gaps = 1/54 (1%) Frame = +1 Query: 37 SPALTISKVLLSIC-SLLCDPNPDDPLVPEIARIYKTDREKYNELAREWTRKYA 195 SP++ +S + S LL PNP DPL + A +Y E+Y + ++ RKYA Sbjct: 65 SPSIDLSNIFESFLPQLLTYPNPIDPLNGDAAAMYLHKPEEYKKKVADYVRKYA 118 >UniRef50_Q54I43 Cluster: Ubiquitin carrier protein; n=3; Eukaryota|Rep: Ubiquitin carrier protein - Dictyostelium discoideum AX4 Length = 215 Score = 38.3 bits (85), Expect = 0.11 Identities = 26/94 (27%), Positives = 46/94 (48%), Gaps = 4/94 (4%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELAREW 180 G IC++ L+ W+ L + +LL+I LL PN + L + +R+ + + Y + A+ + Sbjct: 90 GEICVNTLKKDWTEDLGLKHILLTIKCLLIVPNAESSLNEDASRLLLENYDDYCKHAKLF 149 Query: 181 TRKYAM**V----NCDINKTYTHTSPQPGLYPPT 270 T +A + N + N T T T+ P T Sbjct: 150 TSIHASKPIIDSNNNNENSTTTPTTTTTATTPST 183 >UniRef50_Q6E683 Cluster: Ubiquitin carrier protein; n=1; Antonospora locustae|Rep: Ubiquitin carrier protein - Antonospora locustae (Nosema locustae) Length = 81 Score = 38.3 bits (85), Expect = 0.11 Identities = 18/62 (29%), Positives = 34/62 (54%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELAREW 180 G++CL+ LR WS A+ I ++ I L +P+ ++ L E + + +K+ E AR + Sbjct: 19 GNVCLEFLRHNWSCAMGIEWIVWGIYLFLIEPSGENALNTEAGDLLLYNYDKFAEKARTY 78 Query: 181 TR 186 + Sbjct: 79 AK 80 >UniRef50_P62253 Cluster: Ubiquitin-conjugating enzyme E2 G1; n=66; Eukaryota|Rep: Ubiquitin-conjugating enzyme E2 G1 - Homo sapiens (Human) Length = 170 Score = 38.3 bits (85), Expect = 0.11 Identities = 14/40 (35%), Positives = 25/40 (62%) Frame = +1 Query: 31 QWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDR 150 +W P T+ +++S+ S+L DPN D P + A+ ++ DR Sbjct: 110 RWLPIHTVETIMISVISMLADPNGDSPANVDAAKEWREDR 149 >UniRef50_Q4QAG0 Cluster: Ubiquitin-conjugating enzyme E2, putative; n=3; Leishmania|Rep: Ubiquitin-conjugating enzyme E2, putative - Leishmania major Length = 192 Score = 37.9 bits (84), Expect = 0.14 Identities = 19/61 (31%), Positives = 33/61 (54%), Gaps = 3/61 (4%) Frame = +1 Query: 7 ICLDILRAQWSPALTISKVLLSICSLLCDPNPDDPL---VPEIARIYKTDREKYNELARE 177 +CL ++ +W P TI ++++I L PN DDPL A+I K + ++ +A+ Sbjct: 126 VCLG-MQTEWRPTCTIKDMVVAIEMLFALPNYDDPLPGVAKTAAQILKDEPSRFELIAKR 184 Query: 178 W 180 W Sbjct: 185 W 185 >UniRef50_Q4P8X0 Cluster: Putative uncharacterized protein; n=1; Ustilago maydis|Rep: Putative uncharacterized protein - Ustilago maydis (Smut fungus) Length = 152 Score = 37.9 bits (84), Expect = 0.14 Identities = 17/29 (58%), Positives = 21/29 (72%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVLLSICSLL 87 G IC IL +WSP LTIS VLL++ S+L Sbjct: 89 GHICASILGNEWSPVLTISSVLLTLQSML 117 >UniRef50_Q5VVX9 Cluster: Ubiquitin-conjugating enzyme E2 U; n=11; Eutheria|Rep: Ubiquitin-conjugating enzyme E2 U - Homo sapiens (Human) Length = 321 Score = 37.5 bits (83), Expect = 0.18 Identities = 21/68 (30%), Positives = 35/68 (51%), Gaps = 2/68 (2%) Frame = +1 Query: 1 GSICLDILR--AQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELAR 174 G C+D L +W+ T+S +LL++ +L +P ++P+ E ARI D Y + R Sbjct: 86 GQPCIDFLDNPEKWNTNYTLSSILLALQVMLSNPVLENPVNLEAARILVKDESLYRTILR 145 Query: 175 EWTRKYAM 198 + R M Sbjct: 146 LFNRPLQM 153 >UniRef50_Q4U8F2 Cluster: Ubiquitin carrier protein; n=2; Piroplasmida|Rep: Ubiquitin carrier protein - Theileria annulata Length = 170 Score = 37.1 bits (82), Expect = 0.24 Identities = 16/53 (30%), Positives = 29/53 (54%) Frame = +1 Query: 31 QWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELAREWTRK 189 +W P L + +L+S+ S+L +PN + P + K D ++Y + + TRK Sbjct: 115 RWRPILGVETILISVISMLGEPNLESPANVDAGVQLKNDPKEYRKKVKMLTRK 167 >UniRef50_Q6BZP7 Cluster: Similarity; n=1; Yarrowia lipolytica|Rep: Similarity - Yarrowia lipolytica (Candida lipolytica) Length = 178 Score = 37.1 bits (82), Expect = 0.24 Identities = 19/47 (40%), Positives = 27/47 (57%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYK 141 G ICLDIL +W+P T++ V +S+ S+L N D P+ R K Sbjct: 115 GHICLDILGDEWTPVQTVASVCISLQSML-GSNDRDERPPDDERYIK 160 >UniRef50_UPI000023E382 Cluster: hypothetical protein FG10841.1; n=1; Gibberella zeae PH-1|Rep: hypothetical protein FG10841.1 - Gibberella zeae PH-1 Length = 1077 Score = 36.7 bits (81), Expect = 0.32 Identities = 16/35 (45%), Positives = 24/35 (68%), Gaps = 1/35 (2%) Frame = +1 Query: 1 GSICLDIL-RAQWSPALTISKVLLSICSLLCDPNP 102 GSIC ++L + WSPAL++ KV L + LC+ +P Sbjct: 992 GSICSELLTNSGWSPALSLEKVFLEVRMNLCEKDP 1026 >UniRef50_Q8SR07 Cluster: UBIQUITIN CONJUGATING ENZYME E2-20K; n=1; Encephalitozoon cuniculi|Rep: UBIQUITIN CONJUGATING ENZYME E2-20K - Encephalitozoon cuniculi Length = 151 Score = 36.7 bits (81), Expect = 0.32 Identities = 14/58 (24%), Positives = 32/58 (55%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELAR 174 G++C++ILR W P+ + + +++ + + +D L + ++K+D E + AR Sbjct: 91 GNVCMEILRLGWRPSHGLESIFVNLYVIFVEVTGEDALNTKAGDLFKSDYEGFVRAAR 148 >UniRef50_A6R4R4 Cluster: Putative uncharacterized protein; n=2; Pezizomycotina|Rep: Putative uncharacterized protein - Ajellomyces capsulatus NAm1 Length = 193 Score = 36.7 bits (81), Expect = 0.32 Identities = 19/56 (33%), Positives = 30/56 (53%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNEL 168 G ICLD+L + WSP T+ V +SI S+L N + P A +R++ ++ Sbjct: 130 GIICLDLLGSAWSPVQTVESVCMSIQSMLAG-NTKNERPPGDAEFVARNRQRPRDI 184 >UniRef50_A3LYJ5 Cluster: Predicted protein; n=3; Saccharomycetales|Rep: Predicted protein - Pichia stipitis (Yeast) Length = 182 Score = 36.7 bits (81), Expect = 0.32 Identities = 20/47 (42%), Positives = 28/47 (59%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYK 141 G ICL++L W+PA +I VLLSI S+L + N + P+ A K Sbjct: 119 GHICLNLLGEDWTPACSIESVLLSIQSML-NTNDKNERPPDDAAYVK 164 >UniRef50_UPI0000E487EE Cluster: PREDICTED: similar to ubiquitin conjugating enzyme, partial; n=1; Strongylocentrotus purpuratus|Rep: PREDICTED: similar to ubiquitin conjugating enzyme, partial - Strongylocentrotus purpuratus Length = 162 Score = 36.3 bits (80), Expect = 0.43 Identities = 15/52 (28%), Positives = 32/52 (61%), Gaps = 2/52 (3%) Frame = +1 Query: 31 QWSPALTISKVLLSICSLLCDPNPDDP--LVPEIARIYKTDREKYNELAREW 180 +W P T+ +L+S+ S+L DPN + P + ++ I K +E+++ + +E+ Sbjct: 60 RWLPIHTVETILISVISMLADPNDESPANVDAAVSIIPKRVKERFHPILKEY 111 >UniRef50_Q8ILW5 Cluster: Ubiquitin conjugating enzyme, putative; n=7; Plasmodium|Rep: Ubiquitin conjugating enzyme, putative - Plasmodium falciparum (isolate 3D7) Length = 299 Score = 36.3 bits (80), Expect = 0.43 Identities = 15/29 (51%), Positives = 20/29 (68%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVLLSICSLL 87 G ICL IL WSP L+++ + LSI S+L Sbjct: 235 GHICLSILYDHWSPVLSVNSICLSIISML 263 >UniRef50_Q6FWP7 Cluster: Similar to sp|P40549 Saccharomyces cerevisiae YIL014w MNT3; n=4; Candida glabrata|Rep: Similar to sp|P40549 Saccharomyces cerevisiae YIL014w MNT3 - Candida glabrata (Yeast) (Torulopsis glabrata) Length = 637 Score = 36.3 bits (80), Expect = 0.43 Identities = 19/60 (31%), Positives = 30/60 (50%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELAREW 180 G I DI++ +W L C+ + DP P+D ++ R + + EKYNE+ R W Sbjct: 575 GFIVPDIVKQKWIQYPDCQHYLY--CAFITDP-PEDDNTGKLVRFSEEEMEKYNEIGRAW 631 >UniRef50_O14933 Cluster: Ubiquitin/ISG15-conjugating enzyme E2 L6; n=4; Homo/Pan/Gorilla group|Rep: Ubiquitin/ISG15-conjugating enzyme E2 L6 - Homo sapiens (Human) Length = 152 Score = 36.3 bits (80), Expect = 0.43 Identities = 19/67 (28%), Positives = 37/67 (55%), Gaps = 1/67 (1%) Frame = +1 Query: 1 GSICLDILRAQ-WSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELARE 177 G ICL I+ ++ W P +VL ++ L+ PN +PL ++A + + E + + A E Sbjct: 82 GQICLPIISSENWKPCTKTCQVLEALNVLVNRPNIREPLRMDLADLLTQNPELFRKNAEE 141 Query: 178 WTRKYAM 198 +T ++ + Sbjct: 142 FTLRFGV 148 >UniRef50_UPI0000498417 Cluster: ubiquitin-conjugating enzyme; n=1; Entamoeba histolytica HM-1:IMSS|Rep: ubiquitin-conjugating enzyme - Entamoeba histolytica HM-1:IMSS Length = 219 Score = 35.9 bits (79), Expect = 0.56 Identities = 13/32 (40%), Positives = 21/32 (65%) Frame = +1 Query: 16 DILRAQWSPALTISKVLLSICSLLCDPNPDDP 111 ++ +W P ++S +LLS+ S+LCDPN P Sbjct: 102 ELASERWLPTQSVSSILLSVQSMLCDPNMYSP 133 >UniRef50_Q4Q5I6 Cluster: Ubiquitin carrier protein; n=5; Trypanosomatidae|Rep: Ubiquitin carrier protein - Leishmania major Length = 271 Score = 35.9 bits (79), Expect = 0.56 Identities = 16/30 (53%), Positives = 19/30 (63%) Frame = +1 Query: 31 QWSPALTISKVLLSICSLLCDPNPDDPLVP 120 +W+P TI VLLSI SL DP+P D P Sbjct: 107 RWTPVQTIRSVLLSIVSLWSDPDPSDAGAP 136 >UniRef50_A5DNI5 Cluster: Putative uncharacterized protein; n=1; Pichia guilliermondii|Rep: Putative uncharacterized protein - Pichia guilliermondii (Yeast) (Candida guilliermondii) Length = 155 Score = 35.9 bits (79), Expect = 0.56 Identities = 19/47 (40%), Positives = 27/47 (57%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYK 141 G ICL++L W+PA I +LLSI S+L N ++ P+ R K Sbjct: 92 GHICLNLLGEDWTPACLIESILLSIHSMLVH-NTNNSRPPDDERYIK 137 >UniRef50_A6RY09 Cluster: Putative uncharacterized protein; n=1; Botryotinia fuckeliana B05.10|Rep: Putative uncharacterized protein - Botryotinia fuckeliana B05.10 Length = 167 Score = 35.5 bits (78), Expect = 0.74 Identities = 18/46 (39%), Positives = 27/46 (58%), Gaps = 1/46 (2%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVLLSICSLLCDPNPD-DPLVPEIARI 135 G ICLD+L +W+P L + L SI SL+ + PL +IA++ Sbjct: 95 GEICLDVLGDKWTPVLGVVGALESIASLVAGGGDETSPLNVDIAKL 140 >UniRef50_Q9QZU9 Cluster: Ubiquitin/ISG15-conjugating enzyme E2 L6; n=12; Mammalia|Rep: Ubiquitin/ISG15-conjugating enzyme E2 L6 - Mus musculus (Mouse) Length = 152 Score = 35.5 bits (78), Expect = 0.74 Identities = 18/67 (26%), Positives = 37/67 (55%), Gaps = 1/67 (1%) Frame = +1 Query: 1 GSICLDILRAQ-WSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELARE 177 G +CL ++ + W P +VL ++ L+ PN ++P+ E+A + + E + + A E Sbjct: 82 GLVCLPLISNENWKPYTKPYQVLEALNVLVSKPNLEEPVRLELADLLTQNPEMFRKKAEE 141 Query: 178 WTRKYAM 198 +T K+ + Sbjct: 142 FTLKFGV 148 >UniRef50_UPI0000E4A01C Cluster: PREDICTED: similar to ENSANGP00000017916; n=1; Strongylocentrotus purpuratus|Rep: PREDICTED: similar to ENSANGP00000017916 - Strongylocentrotus purpuratus Length = 206 Score = 35.1 bits (77), Expect = 0.98 Identities = 14/25 (56%), Positives = 18/25 (72%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVLLSI 75 G ICLDIL+ +WSP +S +L SI Sbjct: 168 GGICLDILQNRWSPTYDVSAILTSI 192 >UniRef50_UPI0000499A56 Cluster: ubiquitin-conjugating enzyme; n=1; Entamoeba histolytica HM-1:IMSS|Rep: ubiquitin-conjugating enzyme - Entamoeba histolytica HM-1:IMSS Length = 160 Score = 34.3 bits (75), Expect = 1.7 Identities = 15/39 (38%), Positives = 22/39 (56%), Gaps = 2/39 (5%) Frame = +1 Query: 1 GSICLDILRAQ--WSPALTISKVLLSICSLLCDPNPDDP 111 G ICL IL W P +I ++L+ + LL +PN + P Sbjct: 90 GQICLSILNESYDWKPTTSIKQILVGVQDLLDNPNKESP 128 >UniRef50_A2AX46 Cluster: Ubiquitin carrier protein; n=2; Eukaryota|Rep: Ubiquitin carrier protein - Guillardia theta (Cryptomonas phi) Length = 201 Score = 34.3 bits (75), Expect = 1.7 Identities = 13/38 (34%), Positives = 22/38 (57%) Frame = +1 Query: 16 DILRAQWSPALTISKVLLSICSLLCDPNPDDPLVPEIA 129 ++ +W+P T+ ++LS+ S+L DP D P E A Sbjct: 140 ELASMRWNPVHTVETIVLSVISMLSDPTDDSPANVEAA 177 >UniRef50_A0CD76 Cluster: Ubiquitin carrier protein; n=4; Paramecium tetraurelia|Rep: Ubiquitin carrier protein - Paramecium tetraurelia Length = 232 Score = 34.3 bits (75), Expect = 1.7 Identities = 18/67 (26%), Positives = 35/67 (52%), Gaps = 1/67 (1%) Frame = +1 Query: 1 GSICLDILRAQWSP-ALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELARE 177 G IC++ L+ W+P ++ + I LL P P+ L E +++ + ++Y + A+ Sbjct: 124 GEICVNTLKKDWNPLQWSLKNIFEVIKCLLIVPFPESSLNEEAGKLFMENYDEYFKRAKL 183 Query: 178 WTRKYAM 198 T YA+ Sbjct: 184 LTSIYAI 190 >UniRef50_A0C867 Cluster: Ubiquitin carrier protein; n=4; Oligohymenophorea|Rep: Ubiquitin carrier protein - Paramecium tetraurelia Length = 233 Score = 34.3 bits (75), Expect = 1.7 Identities = 21/71 (29%), Positives = 34/71 (47%), Gaps = 12/71 (16%) Frame = +1 Query: 1 GSICLDILRAQ------------WSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKT 144 G +C+ IL AQ W P LT VL+SI S+L +PN + P + ++ Sbjct: 154 GRVCISILHAQDEFNDQEPPETRWRPILTPEDVLISIVSMLSEPNINSPANVDAGIQFRD 213 Query: 145 DREKYNELARE 177 ++Y + R+ Sbjct: 214 KPDEYKKKVRK 224 >UniRef50_A0A5E9 Cluster: Ubiquitin-conjugating enzyme,; n=1; Toxoplasma gondii RH|Rep: Ubiquitin-conjugating enzyme, - Toxoplasma gondii RH Length = 115 Score = 34.3 bits (75), Expect = 1.7 Identities = 12/29 (41%), Positives = 22/29 (75%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVLLSICSLL 87 G +CL++L + W P+L+IS + ++I S+L Sbjct: 53 GDVCLNLLGSDWRPSLSISAIAVAILSML 81 >UniRef50_Q9VGD6 Cluster: CG14739-PA; n=2; Sophophora|Rep: CG14739-PA - Drosophila melanogaster (Fruit fly) Length = 206 Score = 33.9 bits (74), Expect = 2.3 Identities = 19/67 (28%), Positives = 31/67 (46%), Gaps = 1/67 (1%) Frame = +1 Query: 1 GSICLDILRAQWSPALTISKVLLSIC-SLLCDPNPDDPLVPEIARIYKTDREKYNELARE 177 G +C+++L+ WS + + + + LL PNP D L A I K + + E Sbjct: 91 GLVCMNVLKQAWSSSYDLVNIFETFLPQLLRYPNPHDSLNHRAAAIMKHSEQLFREHVIL 150 Query: 178 WTRKYAM 198 + YAM Sbjct: 151 CMKTYAM 157 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 529,570,824 Number of Sequences: 1657284 Number of extensions: 10844561 Number of successful extensions: 28048 Number of sequences better than 10.0: 268 Number of HSP's better than 10.0 without gapping: 27136 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 28023 length of database: 575,637,011 effective HSP length: 95 effective length of database: 418,195,031 effective search space used: 32619212418 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -