BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS313B10f (521 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q73QD9 Cluster: Putative uncharacterized protein; n=1; ... 32 6.9 UniRef50_A1SZC5 Cluster: Putative uncharacterized protein precur... 32 6.9 >UniRef50_Q73QD9 Cluster: Putative uncharacterized protein; n=1; Treponema denticola|Rep: Putative uncharacterized protein - Treponema denticola Length = 211 Score = 32.3 bits (70), Expect = 6.9 Identities = 19/55 (34%), Positives = 30/55 (54%), Gaps = 1/55 (1%) Frame = +2 Query: 296 LITLPHLEXKDFSVQSEKWXGG-DFXMENNKPFFTKPIGAXXTYLLTGIKFFAIY 457 L+++ +L K SVQ+EK G + + NN +FTK + ++ IKF IY Sbjct: 83 LMSVQYLISKIISVQAEKLYGRQELYLINNSLYFTKDVRIRFNRKISCIKFLEIY 137 >UniRef50_A1SZC5 Cluster: Putative uncharacterized protein precursor; n=1; Psychromonas ingrahamii 37|Rep: Putative uncharacterized protein precursor - Psychromonas ingrahamii (strain 37) Length = 446 Score = 32.3 bits (70), Expect = 6.9 Identities = 15/28 (53%), Positives = 21/28 (75%) Frame = +2 Query: 50 SKFGGNSRASSDELRVEDYFTKRLKIRA 133 S FGG+SR++++ L VEDY+ RL RA Sbjct: 266 SFFGGDSRSNTNHLIVEDYWDARLASRA 293 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 467,130,512 Number of Sequences: 1657284 Number of extensions: 8278831 Number of successful extensions: 13898 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 13650 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13892 length of database: 575,637,011 effective HSP length: 95 effective length of database: 418,195,031 effective search space used: 32619212418 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -