BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS313B10f (521 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 21 5.0 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 21 6.6 AY337337-1|AAP94192.1| 505|Tribolium castaneum cytochrome P450 ... 21 6.6 AM292348-1|CAL23160.2| 346|Tribolium castaneum gustatory recept... 21 6.6 AM292380-1|CAL23192.2| 489|Tribolium castaneum gustatory recept... 21 8.7 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 21.4 bits (43), Expect = 5.0 Identities = 8/20 (40%), Positives = 14/20 (70%) Frame = +2 Query: 38 IPNSSKFGGNSRASSDELRV 97 +P+ S GG+ S+DE++V Sbjct: 1 MPHVSSSGGDDLGSTDEVKV 20 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.0 bits (42), Expect = 6.6 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = -2 Query: 484 NQFYPRDSGIYCKKFYSSQKVGG 416 NQFY R +G K S +GG Sbjct: 1455 NQFYKRVTGYKAKGIKVSLALGG 1477 >AY337337-1|AAP94192.1| 505|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 505 Score = 21.0 bits (42), Expect = 6.6 Identities = 12/43 (27%), Positives = 20/43 (46%) Frame = -1 Query: 131 PVSLDVS*NSPPLLTHPMMLENSLQTYSSLVFLVDHYNIPQLS 3 PV+ +S N PPL T + L+ + L + + N L+ Sbjct: 43 PVNDIISGNIPPLYTSAENIFKQLREWGRLYYPIYKLNAAHLA 85 >AM292348-1|CAL23160.2| 346|Tribolium castaneum gustatory receptor candidate 27 protein. Length = 346 Score = 21.0 bits (42), Expect = 6.6 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = +2 Query: 275 LNNIFLKLITLPHLE 319 LN FLK +T+ H+E Sbjct: 12 LNTFFLKALTVWHVE 26 >AM292380-1|CAL23192.2| 489|Tribolium castaneum gustatory receptor candidate 59 protein. Length = 489 Score = 20.6 bits (41), Expect = 8.7 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = -2 Query: 184 KIYKMTYTVFLRALRVLCPYL*TFRKI 104 KIYK TY + +L Y+ T +I Sbjct: 41 KIYKYTYNIVAVSLTAYMVYITTNLRI 67 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 116,028 Number of Sequences: 336 Number of extensions: 2242 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12573240 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -