BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS313B10f (521 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 22 4.4 AY273778-1|AAP33487.1| 427|Apis mellifera ultraspiracle protein... 21 7.7 AF263459-1|AAF73057.1| 427|Apis mellifera ultraspiracle protein... 21 7.7 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 21.8 bits (44), Expect = 4.4 Identities = 6/20 (30%), Positives = 13/20 (65%) Frame = +2 Query: 326 DFSVQSEKWXGGDFXMENNK 385 D+S+ +W GGD+ + ++ Sbjct: 23 DYSLDEIEWDGGDYEVVESR 42 >AY273778-1|AAP33487.1| 427|Apis mellifera ultraspiracle protein protein. Length = 427 Score = 21.0 bits (42), Expect = 7.7 Identities = 9/32 (28%), Positives = 20/32 (62%) Frame = +2 Query: 113 KRLKIRA*DSEGSEENSISHFIDFSHDLLMNL 208 KR++ + + +G+ EN++SH + ++ L L Sbjct: 215 KRVECKM-EQQGNYENAVSHICNATNKQLFQL 245 >AF263459-1|AAF73057.1| 427|Apis mellifera ultraspiracle protein protein. Length = 427 Score = 21.0 bits (42), Expect = 7.7 Identities = 9/32 (28%), Positives = 20/32 (62%) Frame = +2 Query: 113 KRLKIRA*DSEGSEENSISHFIDFSHDLLMNL 208 KR++ + + +G+ EN++SH + ++ L L Sbjct: 215 KRVECKM-EQQGNYENAVSHICNATNKQLFQL 245 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 137,215 Number of Sequences: 438 Number of extensions: 2535 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14600229 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -