BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS313B08f (521 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC3G9.08 |png1||ING family homolog Png1|Schizosaccharomyces po... 26 3.0 SPCC1739.11c |cdc11||SIN component scaffold protein Cdc11|Schizo... 26 3.9 SPCC16C4.18c |taf50||histone H4-like TAF |Schizosaccharomyces po... 26 3.9 >SPAC3G9.08 |png1||ING family homolog Png1|Schizosaccharomyces pombe|chr 1|||Manual Length = 283 Score = 26.2 bits (55), Expect = 3.0 Identities = 16/61 (26%), Positives = 24/61 (39%) Frame = -1 Query: 332 THRPAHSGGGTPSRTLARTSSPGALISGALTSLTLPNLVGMNGRLAQSAFIHTVTKTIQT 153 T P+ SG T R ++ GA+ +G S +L Q T T ++T Sbjct: 148 TPAPSRSGASTAGRRRTSATTRGAIQNGVYHSPYTASLADSGSTRGQKVSNATATTQLET 207 Query: 152 K 150 K Sbjct: 208 K 208 >SPCC1739.11c |cdc11||SIN component scaffold protein Cdc11|Schizosaccharomyces pombe|chr 3|||Manual Length = 1045 Score = 25.8 bits (54), Expect = 3.9 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -1 Query: 158 QTKTFPLNISN*VQIQTPPHSVRDS 84 Q +FPL N Q + P HS+RD+ Sbjct: 501 QPHSFPLRKQNVAQSEFPKHSLRDN 525 >SPCC16C4.18c |taf50||histone H4-like TAF |Schizosaccharomyces pombe|chr 3|||Manual Length = 452 Score = 25.8 bits (54), Expect = 3.9 Identities = 13/40 (32%), Positives = 22/40 (55%) Frame = -2 Query: 409 RVHIE*RMSSPFRLHQRRTLVLPAGPRTALHTAAVAPPRG 290 R+H + ++ F +H +RT++ A +AL T V P G Sbjct: 38 RIHQVVQEATKFMVHSKRTVLTSADISSALRTLNVEPLYG 77 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,272,981 Number of Sequences: 5004 Number of extensions: 47667 Number of successful extensions: 175 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 157 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 174 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 212331630 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -