BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS313B06f (521 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC613.05c |rpl35||60S ribosomal protein L35|Schizosaccharomyce... 87 2e-18 SPAC806.08c |mod21||gamma tubulin complex subunit Mod21|Schizosa... 25 9.0 >SPCC613.05c |rpl35||60S ribosomal protein L35|Schizosaccharomyces pombe|chr 3|||Manual Length = 122 Score = 86.6 bits (205), Expect = 2e-18 Identities = 49/118 (41%), Positives = 66/118 (55%) Frame = -1 Query: 398 VKCSELRTKDXXXXXXXXXXXXXXLTNLRVAKVTGGVASKLSKIRVVRKAIARVYIVYHQ 219 +K ELR + L +LRV K+ GG SKLSKI+ RK IAR+ V ++ Sbjct: 3 LKTFELRKQSQENLAEQLQELRQELASLRVQKIAGGSGSKLSKIKTTRKDIARILTVINE 62 Query: 218 KMKVNLRXXXXXXXXKPLDLRAKKTRAMRKALTKHEAKIKTRKEIRKKSLFPPRVYAV 45 ++ R PLDLR KKTRA+R+ALT +E KT K+I+K+ FP R YA+ Sbjct: 63 SNRLAAREAYKNKKYIPLDLRQKKTRAIRRALTPYEQSRKTLKQIKKERYFPLRKYAL 120 >SPAC806.08c |mod21||gamma tubulin complex subunit Mod21|Schizosaccharomyces pombe|chr 1|||Manual Length = 618 Score = 24.6 bits (51), Expect = 9.0 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = +1 Query: 403 PILTVTFSHCQIKQDVLSQIYRTHR 477 P L+V F + QIK +LS + TH+ Sbjct: 252 PFLSVVFIYPQIKPHLLSCLKNTHQ 276 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,626,790 Number of Sequences: 5004 Number of extensions: 26174 Number of successful extensions: 67 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 67 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 67 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 212331630 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -