BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS313B06f (521 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex det... 25 0.62 AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine rece... 22 4.4 AY313893-1|AAQ82184.1| 437|Apis mellifera major royal jelly pro... 21 7.7 AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor pr... 21 7.7 AF004842-1|AAD01205.1| 598|Apis mellifera major royal jelly pro... 21 7.7 AF000632-1|AAC61894.1| 452|Apis mellifera major royal jelly pro... 21 7.7 >AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex determiner protein. Length = 426 Score = 24.6 bits (51), Expect = 0.62 Identities = 8/27 (29%), Positives = 17/27 (62%) Frame = +3 Query: 225 IHNVNTCDSFSYNTDLGQFRSNSTSNF 305 IHN N ++ +YN + + +N+ +N+ Sbjct: 323 IHNNNNYNNNNYNNNYNNYNNNNYNNY 349 >AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine receptor protein. Length = 694 Score = 21.8 bits (44), Expect = 4.4 Identities = 8/32 (25%), Positives = 16/32 (50%) Frame = +1 Query: 73 DFFLISFLVLIFASCLVRALRIARVFLALKSK 168 DF + S L + C++ +F AL+++ Sbjct: 342 DFIIYSSLSSFYIPCIIMVFLYYNIFKALRNR 373 >AY313893-1|AAQ82184.1| 437|Apis mellifera major royal jelly protein MRJP6 protein. Length = 437 Score = 21.0 bits (42), Expect = 7.7 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = -2 Query: 514 DCTRFSSNYKGSSDEYDR 461 DC+ S YK + D++DR Sbjct: 121 DCSGIVSAYKIAIDKFDR 138 >AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor protein. Length = 501 Score = 21.0 bits (42), Expect = 7.7 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = +1 Query: 424 SHCQIKQDVLSQIYRT 471 SHC + Q+ QIY T Sbjct: 192 SHCVVCQNFFYQIYAT 207 >AF004842-1|AAD01205.1| 598|Apis mellifera major royal jelly protein MRJP5 protein. Length = 598 Score = 21.0 bits (42), Expect = 7.7 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = -2 Query: 514 DCTRFSSNYKGSSDEYDR 461 DC+ S YK + D++DR Sbjct: 121 DCSGIVSAYKIAIDKFDR 138 >AF000632-1|AAC61894.1| 452|Apis mellifera major royal jelly protein MRJP2 protein. Length = 452 Score = 21.0 bits (42), Expect = 7.7 Identities = 7/18 (38%), Positives = 13/18 (72%) Frame = -2 Query: 514 DCTRFSSNYKGSSDEYDR 461 DC++ S +K + D++DR Sbjct: 118 DCSKIVSAFKIAIDKFDR 135 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 108,817 Number of Sequences: 438 Number of extensions: 1749 Number of successful extensions: 7 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14600229 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -