BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS313B05f (521 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_02_0615 - 12152941-12153726 40 0.001 08_01_0797 + 7711772-7712869 38 0.004 04_04_1221 + 31845938-31847038 38 0.005 07_01_0484 - 3643294-3643478,3644282-3644555,3644646-3645018,364... 38 0.006 08_01_0794 - 7687480-7687798,7687817-7688523 37 0.011 08_01_0203 + 1639993-1641141 36 0.015 08_02_1305 - 26013022-26014107 36 0.020 08_01_0801 - 7750548-7751708 36 0.020 08_01_0799 + 7734031-7735102,7735453-7735475 36 0.026 02_02_0612 - 12142192-12143253 36 0.026 10_08_0064 + 14592534-14592880,14593327-14593576 35 0.034 06_03_1064 - 27300735-27301829 35 0.034 08_02_1310 - 26037025-26038074 35 0.046 08_02_1308 - 26024491-26025405 34 0.060 08_02_0623 - 19429029-19430207 34 0.060 02_02_0618 - 12190727-12191698 34 0.060 10_08_0054 + 14501357-14502478 34 0.080 07_03_1529 + 27491963-27492465,27493045-27493154,27493384-274935... 34 0.080 04_04_1219 + 31835854-31836105,31836481-31837152 34 0.080 11_06_0463 + 23879587-23879771,23879783-23881658 33 0.11 10_08_0051 + 14489255-14490403 33 0.11 06_01_1008 - 7853089-7854147 33 0.11 11_06_0466 + 23903000-23904041,23905282-23905672,23905708-23906188 33 0.14 08_02_1309 - 26029691-26030609,26030850-26030925,26032198-26032579 33 0.14 11_06_0464 + 23894893-23895077,23895148-23895706 33 0.18 10_08_0052 - 14491990-14493108 33 0.18 09_02_0527 + 10234622-10235773 33 0.18 08_02_0286 - 15326876-15328135 33 0.18 08_02_1301 - 25977012-25978037 32 0.24 08_02_0624 - 19434168-19435352 32 0.24 03_06_0266 + 32746379-32746836,32747898-32748273,32748367-327486... 32 0.24 08_01_0811 - 7872886-7873261,7873446-7873861,7874253-7874262,787... 32 0.32 10_08_0056 + 14511651-14512775 31 0.42 08_01_0197 + 1623454-1624566 31 0.42 08_01_0027 - 195321-195932,197206-197415 31 0.42 04_03_0991 - 21500143-21500799,21500834-21501172 31 0.42 10_08_0124 + 14992399-14993478 31 0.56 07_01_0011 - 81696-81892,83345-83621,83841-84189,84280-84644 31 0.56 04_03_0990 - 21481459-21481933,21482140-21482771 31 0.56 10_08_0119 - 14952786-14953931,14954709-14954831 31 0.74 10_08_0053 - 14496494-14497240,14497418-14497501,14497676-14498152 31 0.74 08_01_0657 + 5674907-5674993,5675615-5676583 31 0.74 08_01_0200 + 1632883-1633913,1634620-1634677 31 0.74 08_02_1303 - 26006294-26006513,26006576-26007318 30 0.98 08_02_1121 + 24457413-24457528,24458395-24458552,24458927-244590... 30 0.98 08_01_0803 - 7771507-7772184,7772238-7772325,7772440-7772546 30 0.98 08_01_0802 - 7754561-7755628 30 0.98 04_04_1220 + 31843628-31844755 30 0.98 02_02_0620 + 12210812-12210997,12212397-12212474,12212744-122128... 30 0.98 10_08_0125 - 15000650-15001717 30 1.3 10_08_0118 + 14948636-14949667,14949893-14949953,14951226-14951977 30 1.3 10_08_0087 + 14730936-14732027 30 1.3 10_08_0063 + 14588177-14589343 30 1.3 08_02_1304 - 26008105-26009070 30 1.3 08_02_1251 - 25592537-25593380,25593589-25593893 30 1.3 05_04_0228 - 19224901-19224991,19225095-19225219,19225293-192254... 30 1.3 03_05_0727 - 27170082-27170336,27170398-27170793,27171009-27171014 30 1.3 08_02_1302 - 25990378-25991457 29 1.7 10_08_0055 - 14505747-14506934 29 2.3 09_04_0623 - 19038777-19040561 29 2.3 05_06_0113 + 25708994-25709114,25709276-25709733 29 2.3 10_08_0088 + 14734585-14734762,14735876-14736729 29 3.0 10_08_0079 + 14704086-14705195 29 3.0 09_02_0123 + 4537231-4537366,4538088-4538171,4538432-4538586,453... 29 3.0 09_02_0037 + 3251066-3251086,3251143-3251151,3251249-3251436,325... 29 3.0 02_04_0471 + 23192001-23192102,23192229-23192356,23192440-231931... 29 3.0 02_02_0613 - 12145489-12145590,12145698-12145761,12146180-12146721 29 3.0 09_02_0528 + 10253372-10254556 28 4.0 10_08_0078 + 14699588-14700645,14700739-14700874,14701076-14701096 28 5.2 10_08_0077 + 14690894-14691030,14691258-14691936 28 5.2 10_08_0068 + 14624376-14624975,14625113-14625601 28 5.2 04_03_0994 - 21514495-21515610 28 5.2 11_06_0465 + 23900454-23901530 27 6.9 10_08_0131 - 15078894-15079617,15079898-15080016 27 6.9 09_06_0192 - 21450158-21450276,21451084-21451573,21451750-214518... 27 6.9 04_04_0031 - 22289078-22289521,22289702-22289754,22289839-222900... 27 6.9 12_02_1035 - 25570009-25571241,25571940-25573709,25573797-255751... 27 9.1 11_02_0105 - 8336309-8336392,8336514-8336579,8337279-8337431,833... 27 9.1 10_08_0058 + 14521922-14522779 27 9.1 02_04_0564 + 23905196-23905413,23905631-23905766,23906005-239060... 27 9.1 >02_02_0615 - 12152941-12153726 Length = 261 Score = 40.3 bits (90), Expect = 0.001 Identities = 20/38 (52%), Positives = 25/38 (65%) Frame = +3 Query: 393 LLKNLEDADFTLVSEDGEKFRVHKAILAAHSDVFKAMF 506 LLKN++ AD T E+F HK +LAA S VF+AMF Sbjct: 179 LLKNMDGADVTF-DVGQERFSAHKCVLAARSSVFEAMF 215 >08_01_0797 + 7711772-7712869 Length = 365 Score = 38.3 bits (85), Expect = 0.004 Identities = 23/47 (48%), Positives = 27/47 (57%), Gaps = 1/47 (2%) Frame = +3 Query: 384 FEGLLKNLEDADFTLV-SEDGEKFRVHKAILAAHSDVFKAMFREETI 521 F LL+ ED +V S +GE F HK +LAA S VFKA F E I Sbjct: 180 FGKLLEEEEDVGRDVVFSVEGESFAAHKLVLAARSPVFKAEFYGEMI 226 >04_04_1221 + 31845938-31847038 Length = 366 Score = 37.9 bits (84), Expect = 0.005 Identities = 20/43 (46%), Positives = 29/43 (67%), Gaps = 1/43 (2%) Frame = +3 Query: 375 VHT-FEGLLKNLEDADFTLVSEDGEKFRVHKAILAAHSDVFKA 500 +HT FE +L++ E +D T + G++FR HK +LA S VFKA Sbjct: 180 LHTDFENMLQDGEGSDVTF-TVGGQEFRAHKCVLAFRSPVFKA 221 >07_01_0484 - 3643294-3643478,3644282-3644555,3644646-3645018, 3645177-3645233,3646034-3646458 Length = 437 Score = 37.5 bits (83), Expect = 0.006 Identities = 20/44 (45%), Positives = 26/44 (59%) Frame = +3 Query: 384 FEGLLKNLEDADFTLVSEDGEKFRVHKAILAAHSDVFKAMFREE 515 F LL N E D L S GE+F HK +LAA S VF++ F ++ Sbjct: 215 FGTLLDNHEGVDVVL-SVGGERFHAHKLVLAARSTVFRSKFFDD 257 >08_01_0794 - 7687480-7687798,7687817-7688523 Length = 341 Score = 36.7 bits (81), Expect = 0.011 Identities = 21/42 (50%), Positives = 24/42 (57%) Frame = +3 Query: 375 VHTFEGLLKNLEDADFTLVSEDGEKFRVHKAILAAHSDVFKA 500 + F LL+ E AD T V GEK HK +LAA S VFKA Sbjct: 177 LENFGELLEKGEGADVTFVV-GGEKIAAHKIVLAARSSVFKA 217 >08_01_0203 + 1639993-1641141 Length = 382 Score = 36.3 bits (80), Expect = 0.015 Identities = 20/37 (54%), Positives = 24/37 (64%) Frame = +3 Query: 390 GLLKNLEDADFTLVSEDGEKFRVHKAILAAHSDVFKA 500 GLL + AD TLV GE+F H+A+LA S VFKA Sbjct: 184 GLLGDKGTADVTLVVR-GEEFAAHRAVLAMRSPVFKA 219 >08_02_1305 - 26013022-26014107 Length = 361 Score = 35.9 bits (79), Expect = 0.020 Identities = 18/38 (47%), Positives = 25/38 (65%), Gaps = 2/38 (5%) Frame = +3 Query: 390 GLLKNLEDAD--FTLVSEDGEKFRVHKAILAAHSDVFK 497 GLL + + AD F +V GE+F H+A+LAA S VF+ Sbjct: 175 GLLDSEDGADVTFVVVGGGGERFAAHRAVLAARSPVFR 212 >08_01_0801 - 7750548-7751708 Length = 386 Score = 35.9 bits (79), Expect = 0.020 Identities = 20/39 (51%), Positives = 23/39 (58%) Frame = +3 Query: 384 FEGLLKNLEDADFTLVSEDGEKFRVHKAILAAHSDVFKA 500 F LL++ E AD T GE F VHK +LA S VFKA Sbjct: 191 FANLLQSKEGADVTF-DVAGEPFSVHKLVLAMRSPVFKA 228 >08_01_0799 + 7734031-7735102,7735453-7735475 Length = 364 Score = 35.5 bits (78), Expect = 0.026 Identities = 21/39 (53%), Positives = 23/39 (58%) Frame = +3 Query: 384 FEGLLKNLEDADFTLVSEDGEKFRVHKAILAAHSDVFKA 500 F LL+ E +D T V GEK HK ILAA S VFKA Sbjct: 181 FGELLEKGEGSDVTFVV-GGEKIAAHKIILAARSSVFKA 218 >02_02_0612 - 12142192-12143253 Length = 353 Score = 35.5 bits (78), Expect = 0.026 Identities = 21/44 (47%), Positives = 26/44 (59%), Gaps = 1/44 (2%) Frame = +3 Query: 378 HTFEGLLKNLEDADFTL-VSEDGEKFRVHKAILAAHSDVFKAMF 506 H + LLKN++ D T V +D F HK ILAA S VF+A F Sbjct: 174 HLGDLLLKNMDSTDVTFNVGQD--IFSAHKCILAARSSVFRAEF 215 >10_08_0064 + 14592534-14592880,14593327-14593576 Length = 198 Score = 35.1 bits (77), Expect = 0.034 Identities = 18/38 (47%), Positives = 23/38 (60%) Frame = +3 Query: 387 EGLLKNLEDADFTLVSEDGEKFRVHKAILAAHSDVFKA 500 E LL++ E AD T GE F H+ +LAA S VF+A Sbjct: 28 EALLQSEEGADVTF-EVGGESFAAHRCVLAARSSVFRA 64 >06_03_1064 - 27300735-27301829 Length = 364 Score = 35.1 bits (77), Expect = 0.034 Identities = 21/43 (48%), Positives = 26/43 (60%), Gaps = 1/43 (2%) Frame = +3 Query: 375 VHTFEG-LLKNLEDADFTLVSEDGEKFRVHKAILAAHSDVFKA 500 +H + G LL++ AD T V GE F HKAILA+ S VF A Sbjct: 171 LHAYLGALLESKTGADVTFVVS-GESFAAHKAILASRSPVFMA 212 >08_02_1310 - 26037025-26038074 Length = 349 Score = 34.7 bits (76), Expect = 0.046 Identities = 18/31 (58%), Positives = 21/31 (67%) Frame = +3 Query: 408 EDADFTLVSEDGEKFRVHKAILAAHSDVFKA 500 + AD LV GE FR H+A+LAA S VFKA Sbjct: 177 DTADVALVV-GGETFRAHRAVLAARSPVFKA 206 >08_02_1308 - 26024491-26025405 Length = 304 Score = 34.3 bits (75), Expect = 0.060 Identities = 18/37 (48%), Positives = 23/37 (62%) Frame = +3 Query: 390 GLLKNLEDADFTLVSEDGEKFRVHKAILAAHSDVFKA 500 GLL E D + + DGE F H+A+LAA S VF+A Sbjct: 120 GLLDRGEGTDVSFLV-DGETFPAHRAVLAARSPVFRA 155 >08_02_0623 - 19429029-19430207 Length = 392 Score = 34.3 bits (75), Expect = 0.060 Identities = 18/40 (45%), Positives = 26/40 (65%) Frame = +3 Query: 387 EGLLKNLEDADFTLVSEDGEKFRVHKAILAAHSDVFKAMF 506 E LL++ + +D T V K+ VH+A+LAA S VF+A F Sbjct: 180 EQLLESKKGSDLT-VQVGESKYDVHRAVLAARSPVFRAQF 218 >02_02_0618 - 12190727-12191698 Length = 323 Score = 34.3 bits (75), Expect = 0.060 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = +3 Query: 444 EKFRVHKAILAAHSDVFKAMF 506 E+FR HK ILAA S VF+A+F Sbjct: 197 ERFRAHKCILAARSSVFRALF 217 >10_08_0054 + 14501357-14502478 Length = 373 Score = 33.9 bits (74), Expect = 0.080 Identities = 17/37 (45%), Positives = 25/37 (67%) Frame = +3 Query: 390 GLLKNLEDADFTLVSEDGEKFRVHKAILAAHSDVFKA 500 GLL+++E AD T GE+ H+++LAA S VF+A Sbjct: 190 GLLESMEGADVTF-HVAGEEVPAHRSVLAARSPVFRA 225 >07_03_1529 + 27491963-27492465,27493045-27493154,27493384-27493510, 27494082-27494430,27494975-27495251,27496236-27496333, 27498090-27498214,27498270-27498326,27498328-27498370, 27498581-27498667,27498802-27498882,27499735-27499901, 27499987-27500098,27500188-27500390,27500473-27500607, 27501106-27501205 Length = 857 Score = 33.9 bits (74), Expect = 0.080 Identities = 22/56 (39%), Positives = 30/56 (53%) Frame = +3 Query: 333 PKILNLNVFDKLLTVHTFEGLLKNLEDADFTLVSEDGEKFRVHKAILAAHSDVFKA 500 PKI + V ++ H + LL + + D T DGE F HK +LAA S VF+A Sbjct: 285 PKIYTIPVPPSNMSQHIGQ-LLTDGKRTDITF-EVDGEVFPAHKVVLAARSPVFRA 338 >04_04_1219 + 31835854-31836105,31836481-31837152 Length = 307 Score = 33.9 bits (74), Expect = 0.080 Identities = 18/37 (48%), Positives = 22/37 (59%) Frame = +3 Query: 390 GLLKNLEDADFTLVSEDGEKFRVHKAILAAHSDVFKA 500 G+L +E AD S GE FR H +LAA S VF+A Sbjct: 132 GMLHGVEIADVEF-SVGGEPFRAHACVLAARSPVFRA 167 >11_06_0463 + 23879587-23879771,23879783-23881658 Length = 686 Score = 33.5 bits (73), Expect = 0.11 Identities = 17/36 (47%), Positives = 20/36 (55%) Frame = +3 Query: 393 LLKNLEDADFTLVSEDGEKFRVHKAILAAHSDVFKA 500 LL + AD T GE F H+ +LAA S VFKA Sbjct: 147 LLSTGDGADVTFRVGGGETFAAHRCVLAARSPVFKA 182 Score = 31.5 bits (68), Expect = 0.42 Identities = 18/42 (42%), Positives = 22/42 (52%) Frame = +3 Query: 375 VHTFEGLLKNLEDADFTLVSEDGEKFRVHKAILAAHSDVFKA 500 +H G L E A + DGE F H+ ILAA S VF+A Sbjct: 499 LHRHLGDLLASEAAADVRFNVDGEAFAAHRCILAARSPVFRA 540 >10_08_0051 + 14489255-14490403 Length = 382 Score = 33.5 bits (73), Expect = 0.11 Identities = 19/37 (51%), Positives = 24/37 (64%) Frame = +3 Query: 390 GLLKNLEDADFTLVSEDGEKFRVHKAILAAHSDVFKA 500 GLL++ + AD T GE+ R H+ ILAA S VFKA Sbjct: 192 GLLESGDGADVTF-HVAGEEVRAHRYILAARSPVFKA 227 >06_01_1008 - 7853089-7854147 Length = 352 Score = 33.5 bits (73), Expect = 0.11 Identities = 23/46 (50%), Positives = 25/46 (54%) Frame = +3 Query: 369 LTVHTFEGLLKNLEDADFTLVSEDGEKFRVHKAILAAHSDVFKAMF 506 L +H E LL + AD T V GE F HK ILAA S VF A F Sbjct: 163 LQMHLGELLLSE-KGADVTFVVA-GESFLAHKIILAARSPVFMAEF 206 >11_06_0466 + 23903000-23904041,23905282-23905672,23905708-23906188 Length = 637 Score = 33.1 bits (72), Expect = 0.14 Identities = 17/36 (47%), Positives = 20/36 (55%) Frame = +3 Query: 393 LLKNLEDADFTLVSEDGEKFRVHKAILAAHSDVFKA 500 LL + AD T GE F H+ +LAA S VFKA Sbjct: 205 LLSAGDGADVTFRVAGGEAFTAHRCVLAARSPVFKA 240 >08_02_1309 - 26029691-26030609,26030850-26030925,26032198-26032579 Length = 458 Score = 33.1 bits (72), Expect = 0.14 Identities = 15/36 (41%), Positives = 22/36 (61%) Frame = +3 Query: 393 LLKNLEDADFTLVSEDGEKFRVHKAILAAHSDVFKA 500 L+ + E + + DGE F H+A+LAA S VF+A Sbjct: 266 LILDYEATNHCAILVDGETFPAHRAVLAARSPVFRA 301 >11_06_0464 + 23894893-23895077,23895148-23895706 Length = 247 Score = 32.7 bits (71), Expect = 0.18 Identities = 16/36 (44%), Positives = 20/36 (55%) Frame = +3 Query: 393 LLKNLEDADFTLVSEDGEKFRVHKAILAAHSDVFKA 500 LL + AD T GE F H+ +LAA S VF+A Sbjct: 164 LLSTGDGADVTFRVAGGEAFAAHRCVLAARSPVFRA 199 >10_08_0052 - 14491990-14493108 Length = 372 Score = 32.7 bits (71), Expect = 0.18 Identities = 19/37 (51%), Positives = 23/37 (62%) Frame = +3 Query: 390 GLLKNLEDADFTLVSEDGEKFRVHKAILAAHSDVFKA 500 GLL++ + AD T GE R H+ ILAA S VFKA Sbjct: 188 GLLESGDGADVTF-RVAGEDVRAHRYILAARSPVFKA 223 >09_02_0527 + 10234622-10235773 Length = 383 Score = 32.7 bits (71), Expect = 0.18 Identities = 14/38 (36%), Positives = 25/38 (65%), Gaps = 2/38 (5%) Frame = +3 Query: 396 LKNLEDADFTLV--SEDGEKFRVHKAILAAHSDVFKAM 503 + N +D+ T V DGE+F H+ ++AA S+VF+++ Sbjct: 177 MSNKKDSTLTDVCFDVDGERFNAHRLVMAAQSEVFRSL 214 >08_02_0286 - 15326876-15328135 Length = 419 Score = 32.7 bits (71), Expect = 0.18 Identities = 20/40 (50%), Positives = 24/40 (60%), Gaps = 3/40 (7%) Frame = +3 Query: 390 GLLKNLED---ADFTLVSEDGEKFRVHKAILAAHSDVFKA 500 GL + LED AD T V GE+FR H+ +LAA S V A Sbjct: 181 GLRRMLEDGTGADVTFVVR-GERFRAHRCVLAARSPVLLA 219 >08_02_1301 - 25977012-25978037 Length = 341 Score = 32.3 bits (70), Expect = 0.24 Identities = 16/37 (43%), Positives = 23/37 (62%) Frame = +3 Query: 390 GLLKNLEDADFTLVSEDGEKFRVHKAILAAHSDVFKA 500 G++ + +D + S GE F H+A+LAA S VFKA Sbjct: 163 GIVDRADCSDVSF-SVGGETFHAHRAVLAARSPVFKA 198 >08_02_0624 - 19434168-19435352 Length = 394 Score = 32.3 bits (70), Expect = 0.24 Identities = 18/40 (45%), Positives = 24/40 (60%) Frame = +3 Query: 387 EGLLKNLEDADFTLVSEDGEKFRVHKAILAAHSDVFKAMF 506 E L+ + E +D TL E E + H+A+LAA S VF A F Sbjct: 184 ELLVGSKEGSDVTLQLEQSE-YDAHRAVLAARSPVFSAQF 222 >03_06_0266 + 32746379-32746836,32747898-32748273,32748367-32748640, 32750605-32750789 Length = 430 Score = 32.3 bits (70), Expect = 0.24 Identities = 18/46 (39%), Positives = 26/46 (56%), Gaps = 1/46 (2%) Frame = +3 Query: 384 FEGLLKNLEDADFTLVSEDGEKFRVHKAILAAHSDVFKA-MFREET 518 F LL N E D + + GEKF H+ +LAA S F++ +F E+ Sbjct: 207 FGTLLDNQEGVD-VICNVAGEKFHAHQLVLAARSSFFRSELFEHES 251 >08_01_0811 - 7872886-7873261,7873446-7873861,7874253-7874262, 7874370-7875334 Length = 588 Score = 31.9 bits (69), Expect = 0.32 Identities = 17/31 (54%), Positives = 19/31 (61%) Frame = +3 Query: 408 EDADFTLVSEDGEKFRVHKAILAAHSDVFKA 500 E AD T S DGE F H+ ILA S VF+A Sbjct: 173 EGADVTF-SVDGELFAAHRVILAMRSPVFRA 202 >10_08_0056 + 14511651-14512775 Length = 374 Score = 31.5 bits (68), Expect = 0.42 Identities = 17/36 (47%), Positives = 21/36 (58%) Frame = +3 Query: 393 LLKNLEDADFTLVSEDGEKFRVHKAILAAHSDVFKA 500 LL + AD T GE FR H+ +LAA S VF+A Sbjct: 178 LLDSKHGADVTF-QVGGEAFRAHRYVLAARSPVFRA 212 >08_01_0197 + 1623454-1624566 Length = 370 Score = 31.5 bits (68), Expect = 0.42 Identities = 20/40 (50%), Positives = 24/40 (60%), Gaps = 1/40 (2%) Frame = +3 Query: 384 FEGLLKNLEDADFTL-VSEDGEKFRVHKAILAAHSDVFKA 500 F +LK+ AD T V ED FR H+A+LAA S VF A Sbjct: 185 FAKMLKDGVGADVTFRVGED--TFRAHRAVLAARSPVFHA 222 >08_01_0027 - 195321-195932,197206-197415 Length = 273 Score = 31.5 bits (68), Expect = 0.42 Identities = 21/61 (34%), Positives = 33/61 (54%) Frame = +3 Query: 324 FPSPKILNLNVFDKLLTVHTFEGLLKNLEDADFTLVSEDGEKFRVHKAILAAHSDVFKAM 503 +P+ I N+ K ++ +L AD T+ + DG + HKAILA+ S VF++M Sbjct: 79 WPNESIAVQNIASKS-SLGCLSRMLTESIHADVTINTTDGV-LKAHKAILASCSPVFESM 136 Query: 504 F 506 F Sbjct: 137 F 137 >04_03_0991 - 21500143-21500799,21500834-21501172 Length = 331 Score = 31.5 bits (68), Expect = 0.42 Identities = 17/37 (45%), Positives = 21/37 (56%) Frame = +3 Query: 390 GLLKNLEDADFTLVSEDGEKFRVHKAILAAHSDVFKA 500 GLL E AD T G+ F H+ +LAA S VF+A Sbjct: 168 GLLATGEGADVTF-EVSGKTFAAHRLVLAARSPVFRA 203 >10_08_0124 + 14992399-14993478 Length = 359 Score = 31.1 bits (67), Expect = 0.56 Identities = 19/40 (47%), Positives = 23/40 (57%), Gaps = 1/40 (2%) Frame = +3 Query: 393 LLKNLEDADFTLVSEDGEKFRVHKAILAAHSDVFKA-MFR 509 LL + E D V GE F H+ +LAA S VFKA +FR Sbjct: 180 LLSSKEGTDIEFVVR-GETFAAHRLVLAARSLVFKAELFR 218 >07_01_0011 - 81696-81892,83345-83621,83841-84189,84280-84644 Length = 395 Score = 31.1 bits (67), Expect = 0.56 Identities = 26/78 (33%), Positives = 37/78 (47%) Frame = +3 Query: 273 NLDVGFMKNKSLYIAIAFPSPKILNLNVFDKLLTVHTFEGLLKNLEDADFTLVSEDGEKF 452 N VG +KN+ +PK +++N+ + F LL D + D E+ Sbjct: 147 NCTVGVVKNR-------LETPKNIHINIPPSDMG-RCFNNLLNLRIGCDVSFEVGD-ERV 197 Query: 453 RVHKAILAAHSDVFKAMF 506 + HK ILAA S VFKA F Sbjct: 198 QAHKWILAARSPVFKAQF 215 >04_03_0990 - 21481459-21481933,21482140-21482771 Length = 368 Score = 31.1 bits (67), Expect = 0.56 Identities = 20/44 (45%), Positives = 25/44 (56%), Gaps = 1/44 (2%) Frame = +3 Query: 390 GLLKNLEDADFTLVSEDGEKFRVHKAILAAHSDVFK-AMFREET 518 GLL E AD T E G+ F H+ +LAA S VF+ A+F T Sbjct: 188 GLLATGEGADVTFEVE-GKTFAAHRWVLAARSPVFRVALFGATT 230 >10_08_0119 - 14952786-14953931,14954709-14954831 Length = 422 Score = 30.7 bits (66), Expect = 0.74 Identities = 17/36 (47%), Positives = 20/36 (55%) Frame = +3 Query: 393 LLKNLEDADFTLVSEDGEKFRVHKAILAAHSDVFKA 500 LL + E D V GE F H+ +LAA S VFKA Sbjct: 242 LLSSKEGTDVEFVV-GGETFAAHRLVLAARSPVFKA 276 >10_08_0053 - 14496494-14497240,14497418-14497501,14497676-14498152 Length = 435 Score = 30.7 bits (66), Expect = 0.74 Identities = 18/37 (48%), Positives = 23/37 (62%) Frame = +3 Query: 390 GLLKNLEDADFTLVSEDGEKFRVHKAILAAHSDVFKA 500 GLL++ + AD T GE+ H+ ILAA S VFKA Sbjct: 252 GLLESGDGADVTF-HVAGEEVPAHRYILAARSPVFKA 287 >08_01_0657 + 5674907-5674993,5675615-5676583 Length = 351 Score = 30.7 bits (66), Expect = 0.74 Identities = 19/41 (46%), Positives = 23/41 (56%) Frame = +3 Query: 378 HTFEGLLKNLEDADFTLVSEDGEKFRVHKAILAAHSDVFKA 500 H LL+ AD TLV G+ F H+AILA+ S VF A Sbjct: 173 HHLGELLRRGTGADVTLVVS-GKCFPAHRAILASRSPVFMA 212 >08_01_0200 + 1632883-1633913,1634620-1634677 Length = 362 Score = 30.7 bits (66), Expect = 0.74 Identities = 16/31 (51%), Positives = 19/31 (61%) Frame = +3 Query: 408 EDADFTLVSEDGEKFRVHKAILAAHSDVFKA 500 E AD T + GE F H+ +LAA S VFKA Sbjct: 176 EGADVTFAVQ-GETFTAHRLMLAARSPVFKA 205 >08_02_1303 - 26006294-26006513,26006576-26007318 Length = 320 Score = 30.3 bits (65), Expect = 0.98 Identities = 15/30 (50%), Positives = 19/30 (63%) Frame = +3 Query: 411 DADFTLVSEDGEKFRVHKAILAAHSDVFKA 500 DA F + GE F H+A+LAA S VF+A Sbjct: 167 DASFAV---GGETFHAHRAVLAARSPVFRA 193 >08_02_1121 + 24457413-24457528,24458395-24458552,24458927-24459042, 24459735-24460400 Length = 351 Score = 30.3 bits (65), Expect = 0.98 Identities = 14/33 (42%), Positives = 21/33 (63%) Frame = +3 Query: 417 DFTLVSEDGEKFRVHKAILAAHSDVFKAMFREE 515 D T+ + DG H+AILA+ S VF++MF + Sbjct: 187 DITINATDGS-IMAHRAILASRSPVFRSMFSHD 218 >08_01_0803 - 7771507-7772184,7772238-7772325,7772440-7772546 Length = 290 Score = 30.3 bits (65), Expect = 0.98 Identities = 19/37 (51%), Positives = 22/37 (59%), Gaps = 1/37 (2%) Frame = +3 Query: 393 LLKNLEDADFTL-VSEDGEKFRVHKAILAAHSDVFKA 500 LL++ E AD T V ED F HK +LA S VFKA Sbjct: 112 LLESKEAADVTFYVGED--TFAAHKVVLAMRSPVFKA 146 >08_01_0802 - 7754561-7755628 Length = 355 Score = 30.3 bits (65), Expect = 0.98 Identities = 17/36 (47%), Positives = 21/36 (58%) Frame = +3 Query: 393 LLKNLEDADFTLVSEDGEKFRVHKAILAAHSDVFKA 500 LL++ E AD + GE F HK +LA S VFKA Sbjct: 188 LLESKEGAD-VVFDVAGETFPAHKLVLAMRSPVFKA 222 >04_04_1220 + 31843628-31844755 Length = 375 Score = 30.3 bits (65), Expect = 0.98 Identities = 14/36 (38%), Positives = 23/36 (63%) Frame = +3 Query: 393 LLKNLEDADFTLVSEDGEKFRVHKAILAAHSDVFKA 500 +L+ + AD ++ D + FR H+ +LAA S VF+A Sbjct: 193 MLRGGDGADVVVLVRD-QPFRAHRCVLAARSPVFRA 227 >02_02_0620 + 12210812-12210997,12212397-12212474,12212744-12212848, 12212998-12213022,12213214-12213266,12213523-12213635, 12213777-12213801,12214560-12214601,12214666-12214726, 12216027-12216043,12217143-12217257,12217431-12218659 Length = 682 Score = 30.3 bits (65), Expect = 0.98 Identities = 17/37 (45%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = +3 Query: 393 LLKNLEDADFTLVSEDGE-KFRVHKAILAAHSDVFKA 500 LL +++ +D +V E GE +F H+ +LAA S VFKA Sbjct: 485 LLDSMDGSD--VVFEVGEERFSAHRCVLAARSSVFKA 519 >10_08_0125 - 15000650-15001717 Length = 355 Score = 29.9 bits (64), Expect = 1.3 Identities = 17/39 (43%), Positives = 21/39 (53%) Frame = +3 Query: 384 FEGLLKNLEDADFTLVSEDGEKFRVHKAILAAHSDVFKA 500 F LL + E D + GE F H+ +LAA S VFKA Sbjct: 165 FGDLLVSKEGTDVKFLV-GGEMFAAHRLVLAARSPVFKA 202 >10_08_0118 + 14948636-14949667,14949893-14949953,14951226-14951977 Length = 614 Score = 29.9 bits (64), Expect = 1.3 Identities = 17/39 (43%), Positives = 21/39 (53%) Frame = +3 Query: 384 FEGLLKNLEDADFTLVSEDGEKFRVHKAILAAHSDVFKA 500 F LL + E D + GE F H+ +LAA S VFKA Sbjct: 180 FVDLLVSKEGTDVKFLV-GGEMFAAHRLVLAARSPVFKA 217 >10_08_0087 + 14730936-14732027 Length = 363 Score = 29.9 bits (64), Expect = 1.3 Identities = 16/39 (41%), Positives = 22/39 (56%) Frame = +3 Query: 384 FEGLLKNLEDADFTLVSEDGEKFRVHKAILAAHSDVFKA 500 F LL+ + AD L G+ F H+ +LAA S VF+A Sbjct: 184 FGDLLETEKGADVVL-EVGGQTFAAHRCVLAARSPVFRA 221 >10_08_0063 + 14588177-14589343 Length = 388 Score = 29.9 bits (64), Expect = 1.3 Identities = 17/40 (42%), Positives = 23/40 (57%), Gaps = 4/40 (10%) Frame = +3 Query: 393 LLKNLEDADFTLVSEDGE----KFRVHKAILAAHSDVFKA 500 LL ++E AD TL GE F H+ +LAA S VF++ Sbjct: 199 LLLSMEGADVTLQVGGGEVETTTFAAHRCVLAARSSVFRS 238 >08_02_1304 - 26008105-26009070 Length = 321 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/20 (60%), Positives = 15/20 (75%) Frame = +3 Query: 441 GEKFRVHKAILAAHSDVFKA 500 GE F H+A+LAA S VF+A Sbjct: 162 GETFHAHRAVLAARSPVFRA 181 >08_02_1251 - 25592537-25593380,25593589-25593893 Length = 382 Score = 29.9 bits (64), Expect = 1.3 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = +3 Query: 441 GEKFRVHKAILAAHSDVFKAMFREET 518 GE F H+A+LA S VFKA+ T Sbjct: 232 GETFHAHRALLAVCSPVFKALLLSST 257 >05_04_0228 - 19224901-19224991,19225095-19225219,19225293-19225410, 19225554-19225618,19225760-19225839,19225942-19226005, 19227341-19227480,19227571-19227694,19227781-19227840, 19227922-19227990,19228139-19228288,19229182-19229289, 19229573-19229648,19229960-19230054,19231729-19231803, 19231923-19232043,19232136-19232308,19232647-19232813, 19232944-19233301 Length = 752 Score = 29.9 bits (64), Expect = 1.3 Identities = 14/31 (45%), Positives = 20/31 (64%) Frame = +3 Query: 414 ADFTLVSEDGEKFRVHKAILAAHSDVFKAMF 506 +D T + E G++F H+ L A SD F+AMF Sbjct: 586 SDVTFLVE-GKRFYAHRIALLASSDAFRAMF 615 >03_05_0727 - 27170082-27170336,27170398-27170793,27171009-27171014 Length = 218 Score = 29.9 bits (64), Expect = 1.3 Identities = 14/29 (48%), Positives = 16/29 (55%) Frame = +3 Query: 411 DADFTLVSEDGEKFRVHKAILAAHSDVFK 497 D L S E F H+A+LAA S VFK Sbjct: 63 DGSDVLFSVGSETFHAHRAVLAARSPVFK 91 >08_02_1302 - 25990378-25991457 Length = 359 Score = 29.5 bits (63), Expect = 1.7 Identities = 14/36 (38%), Positives = 18/36 (50%) Frame = +3 Query: 390 GLLKNLEDADFTLVSEDGEKFRVHKAILAAHSDVFK 497 G + D S GE F H+A+LAA S VF+ Sbjct: 172 GAMVGSADGSDVSFSVGGETFHAHRAVLAARSPVFR 207 >10_08_0055 - 14505747-14506934 Length = 395 Score = 29.1 bits (62), Expect = 2.3 Identities = 18/38 (47%), Positives = 22/38 (57%), Gaps = 1/38 (2%) Frame = +3 Query: 390 GLLKNLE-DADFTLVSEDGEKFRVHKAILAAHSDVFKA 500 GLL E AD T + GE F H+ +LAA S VF+A Sbjct: 190 GLLAAKELGADVTFLVA-GETFTAHRCVLAARSPVFRA 226 >09_04_0623 - 19038777-19040561 Length = 594 Score = 29.1 bits (62), Expect = 2.3 Identities = 15/30 (50%), Positives = 20/30 (66%), Gaps = 1/30 (3%) Frame = +3 Query: 321 AFPSPKILNLN-VFDKLLTVHTFEGLLKNL 407 A P LNL VFD++LTV T+ GL K++ Sbjct: 461 AAPKGSSLNLQGVFDRILTVATYGGLAKDM 490 >05_06_0113 + 25708994-25709114,25709276-25709733 Length = 192 Score = 29.1 bits (62), Expect = 2.3 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = +3 Query: 411 DADFTLVSEDGEKFRVHKAILAAHSDVFKA 500 D F + G +F H+ +LAA S VFKA Sbjct: 45 DVAFEVGGGGGVRFAAHRCVLAARSKVFKA 74 >10_08_0088 + 14734585-14734762,14735876-14736729 Length = 343 Score = 28.7 bits (61), Expect = 3.0 Identities = 15/39 (38%), Positives = 22/39 (56%) Frame = +3 Query: 384 FEGLLKNLEDADFTLVSEDGEKFRVHKAILAAHSDVFKA 500 F LL+ + AD + G+ F H+ +LAA S VF+A Sbjct: 164 FGDLLETEKGAD-VVFEVGGQTFAAHRCVLAARSPVFRA 201 >10_08_0079 + 14704086-14705195 Length = 369 Score = 28.7 bits (61), Expect = 3.0 Identities = 15/39 (38%), Positives = 22/39 (56%) Frame = +3 Query: 384 FEGLLKNLEDADFTLVSEDGEKFRVHKAILAAHSDVFKA 500 F LL+ + AD + G+ F H+ +LAA S VF+A Sbjct: 189 FGDLLETEKGAD-VVFEVGGQTFAAHRCVLAARSPVFRA 226 >09_02_0123 + 4537231-4537366,4538088-4538171,4538432-4538586, 4539115-4539294,4539814-4540169,4540797-4540953 Length = 355 Score = 28.7 bits (61), Expect = 3.0 Identities = 11/35 (31%), Positives = 21/35 (60%) Frame = +3 Query: 186 NTRENSNSTQIEGEPELGCLEYVSTYNFSNLDVGF 290 ++++NS+ ++EG E CL Y ++ +L V F Sbjct: 74 SSQKNSHLQKLEGAKERLCLNYADVMDYDSLSVAF 108 >09_02_0037 + 3251066-3251086,3251143-3251151,3251249-3251436, 3252117-3252148,3252458-3252492,3252693-3253334 Length = 308 Score = 28.7 bits (61), Expect = 3.0 Identities = 13/22 (59%), Positives = 14/22 (63%) Frame = +3 Query: 432 SEDGEKFRVHKAILAAHSDVFK 497 S GE F H A+LAA S VFK Sbjct: 142 SVGGEMFHAHHAVLAARSPVFK 163 >02_04_0471 + 23192001-23192102,23192229-23192356,23192440-23193108, 23193900-23194086 Length = 361 Score = 28.7 bits (61), Expect = 3.0 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = +3 Query: 414 ADFTLVSEDGEKFRVHKAILAAHSDVFKAMFRE 512 AD +V+ DG R H ++LA+ S V + M + Sbjct: 15 ADVRVVTADGSGIRAHSSVLASASPVLERMIEQ 47 >02_02_0613 - 12145489-12145590,12145698-12145761,12146180-12146721 Length = 235 Score = 28.7 bits (61), Expect = 3.0 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = +3 Query: 450 FRVHKAILAAHSDVFKAMF 506 F HK ILAA S VFKA F Sbjct: 15 FSAHKCILAARSSVFKAEF 33 >09_02_0528 + 10253372-10254556 Length = 394 Score = 28.3 bits (60), Expect = 4.0 Identities = 12/35 (34%), Positives = 18/35 (51%) Frame = +3 Query: 396 LKNLEDADFTLVSEDGEKFRVHKAILAAHSDVFKA 500 + N D DG+ F H+ I+A S+VF+A Sbjct: 179 MSNGRDLTDVCFDVDGKSFHAHRLIMARQSEVFRA 213 >10_08_0078 + 14699588-14700645,14700739-14700874,14701076-14701096 Length = 404 Score = 27.9 bits (59), Expect = 5.2 Identities = 15/36 (41%), Positives = 21/36 (58%) Frame = +3 Query: 393 LLKNLEDADFTLVSEDGEKFRVHKAILAAHSDVFKA 500 LL+ + AD + GE+F H+ +LAA S VF A Sbjct: 190 LLETEKGAD-VVFEVAGERFAAHRCVLAARSPVFGA 224 >10_08_0077 + 14690894-14691030,14691258-14691936 Length = 271 Score = 27.9 bits (59), Expect = 5.2 Identities = 15/36 (41%), Positives = 21/36 (58%) Frame = +3 Query: 393 LLKNLEDADFTLVSEDGEKFRVHKAILAAHSDVFKA 500 LL+ + AD + GE+F H+ +LAA S VF A Sbjct: 105 LLETEKGAD-VVFEVAGERFAAHRCVLAARSPVFGA 139 >10_08_0068 + 14624376-14624975,14625113-14625601 Length = 362 Score = 27.9 bits (59), Expect = 5.2 Identities = 16/39 (41%), Positives = 22/39 (56%) Frame = +3 Query: 384 FEGLLKNLEDADFTLVSEDGEKFRVHKAILAAHSDVFKA 500 F LL + + AD +KF H+++LAA S VFKA Sbjct: 185 FGDLLLSKQGADVKF-QVGKKKFDAHRSVLAARSPVFKA 222 >04_03_0994 - 21514495-21515610 Length = 371 Score = 27.9 bits (59), Expect = 5.2 Identities = 16/35 (45%), Positives = 19/35 (54%) Frame = +3 Query: 390 GLLKNLEDADFTLVSEDGEKFRVHKAILAAHSDVF 494 GLL AD T DG+ F H+ +LAA S VF Sbjct: 190 GLLATGVGADVTF-EVDGKTFLAHRNVLAARSPVF 223 >11_06_0465 + 23900454-23901530 Length = 358 Score = 27.5 bits (58), Expect = 6.9 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +3 Query: 441 GEKFRVHKAILAAHSDVFKA 500 GE F H+ +LAA S VF+A Sbjct: 200 GETFPAHRCVLAARSPVFRA 219 >10_08_0131 - 15078894-15079617,15079898-15080016 Length = 280 Score = 27.5 bits (58), Expect = 6.9 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = +3 Query: 441 GEKFRVHKAILAAHSDVFKA 500 GE F H+ +LAA S VFKA Sbjct: 108 GEMFAAHRLVLAARSLVFKA 127 >09_06_0192 - 21450158-21450276,21451084-21451573,21451750-21451862, 21451992-21452376,21452461-21452529,21453165-21453264, 21454465-21454637,21454737-21454782,21454879-21454954, 21455160-21455196,21455799-21456041 Length = 616 Score = 27.5 bits (58), Expect = 6.9 Identities = 16/48 (33%), Positives = 28/48 (58%) Frame = +3 Query: 93 SISISYGSEMEIDKKQKIVRLTKSLKEYKFENTRENSNSTQIEGEPEL 236 S ++ Y S I +Q R + L + FEN R++S++++ E EPE+ Sbjct: 233 SNAMCYNSPDTIYYRQ--ARAIQELAKKDFENLRQDSDASEPEPEPEI 278 >04_04_0031 - 22289078-22289521,22289702-22289754,22289839-22290092, 22290189-22290604,22290683-22290970 Length = 484 Score = 27.5 bits (58), Expect = 6.9 Identities = 25/96 (26%), Positives = 46/96 (47%), Gaps = 2/96 (2%) Frame = +3 Query: 30 EQVGDIFLLHIFIQRYCEGSFSISISYGSEMEIDKKQKIVRLTKSLKEYK--FENTRENS 203 E + D + HI + +F+++ S GS I + +++RL + YK +N R+N+ Sbjct: 293 EDLPDELIFHINYLGADQPTFTLNFSKGSNQIIAQYYQLIRL--GFEGYKDIMQNCRDNA 350 Query: 204 NSTQIEGEPELGCLEYVSTYNFSNLDVGFMKNKSLY 311 + EG + G + VS + L +K+ S Y Sbjct: 351 TVLR-EGIEKTGHFDVVSKDSGVPLVAFSLKDSSRY 385 >12_02_1035 - 25570009-25571241,25571940-25573709,25573797-25575118, 25575208-25575555,25576540-25576633 Length = 1588 Score = 27.1 bits (57), Expect = 9.1 Identities = 16/62 (25%), Positives = 32/62 (51%) Frame = +3 Query: 30 EQVGDIFLLHIFIQRYCEGSFSISISYGSEMEIDKKQKIVRLTKSLKEYKFENTRENSNS 209 +++GD+ L + ++++ + SI S GSE+ +++ + R TK LK + N Sbjct: 959 KKLGDLQLENNYLEKELSKTMSICDSSGSEIGAGRRRTMRRDTKLLKSGRKSQQESTVNI 1018 Query: 210 TQ 215 Q Sbjct: 1019 EQ 1020 >11_02_0105 - 8336309-8336392,8336514-8336579,8337279-8337431, 8337511-8337633,8337989-8338075,8338832-8338984, 8339069-8339152,8339252-8339320,8339622-8339705, 8339836-8340052,8341034-8341239 Length = 441 Score = 27.1 bits (57), Expect = 9.1 Identities = 16/49 (32%), Positives = 26/49 (53%), Gaps = 2/49 (4%) Frame = +3 Query: 261 YNFSNLDVGFMKNKSLYIAIAFPSPKILN--LNVFDKLLTVHTFEGLLK 401 YN +L VG K+K+L+ + + KIL + +KL+ V + L K Sbjct: 99 YNIESLAVGLNKDKALFTIVVSGTEKILKQVVEQLNKLVNVIQVDDLSK 147 >10_08_0058 + 14521922-14522779 Length = 285 Score = 27.1 bits (57), Expect = 9.1 Identities = 16/39 (41%), Positives = 21/39 (53%) Frame = +3 Query: 384 FEGLLKNLEDADFTLVSEDGEKFRVHKAILAAHSDVFKA 500 F LL + + AD GE H+A+LAA S VF+A Sbjct: 124 FADLLASGDGADVEF-RVGGETVAAHRAVLAARSRVFRA 161 >02_04_0564 + 23905196-23905413,23905631-23905766,23906005-23906082, 23906627-23906710,23906826-23906894,23906974-23907057, 23907143-23907301,23907922-23908008,23908398-23908502, 23908579-23908701,23908780-23908932,23909248-23909313, 23909398-23909499 Length = 487 Score = 27.1 bits (57), Expect = 9.1 Identities = 13/45 (28%), Positives = 25/45 (55%), Gaps = 2/45 (4%) Frame = +3 Query: 261 YNFSNLDVGFMKNKSLYIAIAFPSPKILN--LNVFDKLLTVHTFE 389 YN +L VG K+K+++ + + ++LN + +KL+ V E Sbjct: 76 YNIESLAVGLNKDKAMFTIVVSGTDRVLNQVIEQLNKLVNVLNLE 120 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,922,071 Number of Sequences: 37544 Number of extensions: 236177 Number of successful extensions: 641 Number of sequences better than 10.0: 80 Number of HSP's better than 10.0 without gapping: 628 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 641 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1142636160 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -