BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS313B05f (521 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chlor... 23 1.4 DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chlor... 23 1.4 AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor ... 22 3.3 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 21 7.7 >DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 23.4 bits (48), Expect = 1.4 Identities = 12/48 (25%), Positives = 21/48 (43%) Frame = -2 Query: 472 RMALCTLNFSPSSDTKVKSASSKFLSNPSKV*TVNNLSKTFRFSIFGL 329 RM C L+ P +S SKF + ++ ++ + F+ F L Sbjct: 385 RMQHCELHMQPRKKNCCRSWLSKFPTRSKRIDVISRIFFPIVFAFFNL 432 >DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 23.4 bits (48), Expect = 1.4 Identities = 12/48 (25%), Positives = 21/48 (43%) Frame = -2 Query: 472 RMALCTLNFSPSSDTKVKSASSKFLSNPSKV*TVNNLSKTFRFSIFGL 329 RM C L+ P +S SKF + ++ ++ + F+ F L Sbjct: 385 RMQHCELHMQPRKKNCCRSWLSKFPTRSKRIDVISRIFFPIVFAFFNL 432 >AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor A isoform protein. Length = 567 Score = 22.2 bits (45), Expect = 3.3 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = +3 Query: 168 KEYKFENTRENSNSTQIEGEPELG 239 KE K + ++ NST + G P G Sbjct: 268 KEEKAQKEKDKPNSTTMNGSPGSG 291 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 21.0 bits (42), Expect = 7.7 Identities = 7/17 (41%), Positives = 12/17 (70%) Frame = +3 Query: 336 KILNLNVFDKLLTVHTF 386 K +N+N+ D +VH+F Sbjct: 912 KFMNVNMLDTYESVHSF 928 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 145,485 Number of Sequences: 438 Number of extensions: 3063 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14600229 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -