BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS313B04f (484 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292349-1|CAL23161.1| 248|Tribolium castaneum gustatory recept... 25 0.48 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 23 1.1 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 23 1.1 AM292376-1|CAL23188.2| 402|Tribolium castaneum gustatory recept... 21 4.5 AM292332-1|CAL23144.2| 344|Tribolium castaneum gustatory recept... 21 4.5 AM292352-1|CAL23164.1| 250|Tribolium castaneum gustatory recept... 21 6.0 AM292337-1|CAL23149.2| 452|Tribolium castaneum gustatory recept... 21 6.0 AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase ... 21 7.9 AM292364-1|CAL23176.2| 353|Tribolium castaneum gustatory recept... 21 7.9 >AM292349-1|CAL23161.1| 248|Tribolium castaneum gustatory receptor candidate 28 protein. Length = 248 Score = 24.6 bits (51), Expect = 0.48 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = +3 Query: 3 VNFYS*KIWNSLYDANFVGNVQCVIIS 83 V+FY S Y NF G++Q +IIS Sbjct: 110 VHFYYPVATMSFYVLNFFGSIQFIIIS 136 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 23.4 bits (48), Expect = 1.1 Identities = 12/34 (35%), Positives = 16/34 (47%) Frame = -1 Query: 295 WMPTTSLNSLSRLKQQ*RRLKITTPWSLLFTQVQ 194 WMP+T N L L +KI S+L+ Q Sbjct: 853 WMPSTMANILDLLMDYEHTVKINENISMLYIGYQ 886 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 23.4 bits (48), Expect = 1.1 Identities = 12/34 (35%), Positives = 16/34 (47%) Frame = -1 Query: 295 WMPTTSLNSLSRLKQQ*RRLKITTPWSLLFTQVQ 194 WMP+T N L L +KI S+L+ Q Sbjct: 853 WMPSTMANILDLLMDYEHTVKINENISMLYIGYQ 886 >AM292376-1|CAL23188.2| 402|Tribolium castaneum gustatory receptor candidate 55 protein. Length = 402 Score = 21.4 bits (43), Expect = 4.5 Identities = 11/36 (30%), Positives = 18/36 (50%) Frame = +3 Query: 186 VLVCTCVNNKDQGVVIFNLLHCCFRREREFNDVVGI 293 ++VC V D+ V I+ L++ C + ND I Sbjct: 288 MIVCPIVWLMDEVVEIYLLVYACASTCEQANDTPSI 323 >AM292332-1|CAL23144.2| 344|Tribolium castaneum gustatory receptor candidate 11 protein. Length = 344 Score = 21.4 bits (43), Expect = 4.5 Identities = 11/36 (30%), Positives = 18/36 (50%) Frame = +3 Query: 186 VLVCTCVNNKDQGVVIFNLLHCCFRREREFNDVVGI 293 ++VC V D+ V I+ L++ C + ND I Sbjct: 288 MIVCPIVWLMDEVVEIYLLVYACASTCEQANDTPSI 323 >AM292352-1|CAL23164.1| 250|Tribolium castaneum gustatory receptor candidate 31 protein. Length = 250 Score = 21.0 bits (42), Expect = 6.0 Identities = 6/14 (42%), Positives = 9/14 (64%) Frame = +3 Query: 291 IHAISLRQRLPWVF 332 +HAI++R W F Sbjct: 91 VHAITIRSTFSWTF 104 >AM292337-1|CAL23149.2| 452|Tribolium castaneum gustatory receptor candidate 16 protein. Length = 452 Score = 21.0 bits (42), Expect = 6.0 Identities = 8/30 (26%), Positives = 14/30 (46%) Frame = +1 Query: 178 LIWCLFALV*TIKTKVLLSSIFFIAASDVR 267 L+W + + ++ +FF SDVR Sbjct: 256 LLWITVTFILLVGDSYIVMYVFFFHLSDVR 285 Score = 20.6 bits (41), Expect = 7.9 Identities = 8/13 (61%), Positives = 11/13 (84%) Frame = -3 Query: 56 NKIGII*TVPYFL 18 +KIGI+ TV YF+ Sbjct: 35 SKIGIVQTVAYFV 47 >AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase protein. Length = 677 Score = 20.6 bits (41), Expect = 7.9 Identities = 11/34 (32%), Positives = 15/34 (44%) Frame = -1 Query: 295 WMPTTSLNSLSRLKQQ*RRLKITTPWSLLFTQVQ 194 WMP+T N L L +KI S+ + Q Sbjct: 620 WMPSTMANILDLLMDYEHTVKINENISMPYIGYQ 653 >AM292364-1|CAL23176.2| 353|Tribolium castaneum gustatory receptor candidate 43 protein. Length = 353 Score = 20.6 bits (41), Expect = 7.9 Identities = 6/17 (35%), Positives = 11/17 (64%) Frame = +3 Query: 171 CSLDMVLVCTCVNNKDQ 221 C L ++++C CV + Q Sbjct: 266 CLLSLIILCDCVVKEAQ 282 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 103,525 Number of Sequences: 336 Number of extensions: 1965 Number of successful extensions: 11 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 122,585 effective HSP length: 52 effective length of database: 105,113 effective search space used: 11352204 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -