BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS313B03f (521 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z82051-4|CAB04818.2| 339|Caenorhabditis elegans Hypothetical pr... 27 6.2 U40060-3|AAA81142.2| 974|Caenorhabditis elegans Hypothetical pr... 27 6.2 >Z82051-4|CAB04818.2| 339|Caenorhabditis elegans Hypothetical protein T23D5.7 protein. Length = 339 Score = 27.5 bits (58), Expect = 6.2 Identities = 11/33 (33%), Positives = 20/33 (60%) Frame = -2 Query: 493 NIELQRLPSHTARNLRFRSHRCVMDLTFLXEIQ 395 N+ Q LP+ T +R+R C +++TF+ +Q Sbjct: 184 NLIYQNLPNSTDTFIRWRCVMCTLNMTFIMIVQ 216 >U40060-3|AAA81142.2| 974|Caenorhabditis elegans Hypothetical protein F38B6.4 protein. Length = 974 Score = 27.5 bits (58), Expect = 6.2 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = +3 Query: 150 CDCQWNTKSIIRFF*FTNNYPK 215 CD W+TKS+ + NYPK Sbjct: 317 CDINWSTKSVCGVVLASGNYPK 338 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,567,772 Number of Sequences: 27780 Number of extensions: 220988 Number of successful extensions: 398 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 390 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 398 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 1017709248 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -