BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS313B02f (521 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_16903| Best HMM Match : No HMM Matches (HMM E-Value=.) 126 1e-29 SB_46996| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.3 SB_57776| Best HMM Match : EB (HMM E-Value=2.9) 29 3.1 SB_55500| Best HMM Match : Ribosomal_L7Ae (HMM E-Value=2.8e-24) 28 4.1 SB_48160| Best HMM Match : Cytochrom_C (HMM E-Value=1.8e-05) 28 4.1 SB_35585| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.4 SB_19395| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.4 SB_40833| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_49725| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 >SB_16903| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 263 Score = 126 bits (304), Expect = 1e-29 Identities = 59/118 (50%), Positives = 74/118 (62%) Frame = +1 Query: 166 NPLFEKRPKNFAIGQGIQPTRDLSRFVRWPKYIRIQRQKAVLQRRLKVPPPINQFTQTLD 345 NPL EKRP+NF IG IQP RDLSRFVRWP+Y+++QRQK++L +RLKVPP INQFTQ LD Sbjct: 29 NPLIEKRPRNFGIGGDIQPKRDLSRFVRWPRYVKLQRQKSLLYQRLKVPPAINQFTQALD 88 Query: 346 KTTAKGLFKILEKYRPETXXXXXXXXXXXXXXXXXXXXXXXXXRPNTIRSGTNTVTKL 519 + + LFK+L KYRPET +P ++ G N +T L Sbjct: 89 RQSTVQLFKLLHKYRPETKAEKKARLSAKAEKKAEGKEEAPGKKPMLVKYGINHITSL 146 >SB_46996| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 227 Score = 29.1 bits (62), Expect = 2.3 Identities = 15/58 (25%), Positives = 29/58 (50%), Gaps = 1/58 (1%) Frame = +3 Query: 159 DRESSLREEAKELCYWSGHSANS*LVQ-ICKMAQVYPHPAPEGCTSASSESAPSDQPI 329 DR ++ E KE+CYW GH + + + + + + T+++SE S +P+ Sbjct: 137 DRRKNMEERHKEMCYW-GHKFETYVTKLVSERGKRETVMGASTSTASTSEGGASAKPV 193 >SB_57776| Best HMM Match : EB (HMM E-Value=2.9) Length = 669 Score = 28.7 bits (61), Expect = 3.1 Identities = 15/58 (25%), Positives = 28/58 (48%), Gaps = 1/58 (1%) Frame = +3 Query: 159 DRESSLREEAKELCYWSGHSANS*LVQ-ICKMAQVYPHPAPEGCTSASSESAPSDQPI 329 DR ++ E KE+CYW GH + + + + + + T++ SE S +P+ Sbjct: 187 DRRKNMEERHKEMCYW-GHKFETYVTKLVSERGKRETVMGASTSTASKSEGGASAKPV 243 >SB_55500| Best HMM Match : Ribosomal_L7Ae (HMM E-Value=2.8e-24) Length = 172 Score = 28.3 bits (60), Expect = 4.1 Identities = 15/52 (28%), Positives = 20/52 (38%) Frame = +1 Query: 364 LFKILEKYRPETXXXXXXXXXXXXXXXXXXXXXXXXXRPNTIRSGTNTVTKL 519 LFK+L KYRPET +P ++ G N +T L Sbjct: 4 LFKLLHKYRPETKAEKKARLSAKAEKKAEGKEEAPGKKPMLVKYGINHITSL 55 >SB_48160| Best HMM Match : Cytochrom_C (HMM E-Value=1.8e-05) Length = 212 Score = 28.3 bits (60), Expect = 4.1 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = -3 Query: 477 PLWWRLIFLGNLSFSSFPQPLFPG 406 P WW ++F+G + FS L+PG Sbjct: 56 PKWWFMLFIGTIVFSIGYLVLYPG 79 >SB_35585| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 655 Score = 27.9 bits (59), Expect = 5.4 Identities = 12/19 (63%), Positives = 14/19 (73%) Frame = +3 Query: 288 TSASSESAPSDQPIYPDTG 344 T+ASSE+APS P PD G Sbjct: 43 TAASSEAAPSSAPSMPDYG 61 >SB_19395| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 832 Score = 27.9 bits (59), Expect = 5.4 Identities = 17/50 (34%), Positives = 23/50 (46%) Frame = +1 Query: 235 SRFVRWPKYIRIQRQKAVLQRRLKVPPPINQFTQTLDKTTAKGLFKILEK 384 SR RW Y R+ KA+LQR ++ I Q T + K +L K Sbjct: 508 SRTFRWDPYSRMSTLKALLQRMEQLKTQIVQETCEIKKLEKLSRLVLLRK 557 >SB_40833| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1300 Score = 27.1 bits (57), Expect = 9.4 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = +3 Query: 282 GCTSASSESAPSDQPIYPDTGQDYS 356 GC ++ PS+ P YP T + YS Sbjct: 1229 GCRPSNDRVKPSEMPHYPKTTEKYS 1253 >SB_49725| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 708 Score = 27.1 bits (57), Expect = 9.4 Identities = 15/35 (42%), Positives = 23/35 (65%) Frame = -3 Query: 384 FLQNLEKALSCSLVQCLGKLVDRRGHFQTTLKYSL 280 F+QNL L CS ++ G+LV+++ QTTL +L Sbjct: 28 FIQNLSLFL-CSFLKEHGQLVEKKVDLQTTLLEAL 61 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,192,149 Number of Sequences: 59808 Number of extensions: 253333 Number of successful extensions: 710 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 676 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 710 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1172759136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -