BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS313B01f (521 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF388659-2|AAK71994.1| 463|Apis mellifera 1D-myo-inositol-trisp... 22 3.3 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 21 7.7 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 21 7.7 >AF388659-2|AAK71994.1| 463|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform B protein. Length = 463 Score = 22.2 bits (45), Expect = 3.3 Identities = 9/30 (30%), Positives = 18/30 (60%) Frame = -1 Query: 176 MLNCLHRERRNPRCVARKRSNAGAQLQCVI 87 +L + +RNP V RK+S+ +L+ ++ Sbjct: 112 LLGIVDDYQRNPSVVGRKKSSGWRKLRNIV 141 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 21.0 bits (42), Expect = 7.7 Identities = 7/21 (33%), Positives = 13/21 (61%) Frame = -1 Query: 413 VPNVLPKSVSCSTLAKKMMYV 351 VP++ P+ V C+ L + + V Sbjct: 1110 VPSIPPEDVRCAALTSQSLQV 1130 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 21.0 bits (42), Expect = 7.7 Identities = 7/21 (33%), Positives = 13/21 (61%) Frame = -1 Query: 413 VPNVLPKSVSCSTLAKKMMYV 351 VP++ P+ V C+ L + + V Sbjct: 1106 VPSIPPEDVRCAALTSQSLQV 1126 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 120,044 Number of Sequences: 438 Number of extensions: 2034 Number of successful extensions: 5 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14600229 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -