BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS313A10f (521 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF222296-1|ABN79656.2| 403|Tribolium castaneum arginine vasopre... 26 0.18 AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxida... 22 2.9 AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase ... 22 2.9 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 22 2.9 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 22 2.9 AM292370-1|CAL23182.1| 418|Tribolium castaneum gustatory recept... 21 5.0 AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxida... 21 6.6 DQ855506-1|ABH88193.1| 124|Tribolium castaneum chemosensory pro... 21 8.7 DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 21 8.7 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 21 8.7 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 21 8.7 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 21 8.7 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 21 8.7 >EF222296-1|ABN79656.2| 403|Tribolium castaneum arginine vasopressin receptor protein. Length = 403 Score = 26.2 bits (55), Expect = 0.18 Identities = 16/42 (38%), Positives = 22/42 (52%), Gaps = 1/42 (2%) Frame = +1 Query: 88 LSQGWLTIDLEH*YLHGAECAVLRLLYLGCKSC*NP-VYPIF 210 L+Q W T D + ++ G +L LLY SC NP +Y F Sbjct: 282 LAQLWATWDPQSPFIDGPVFVILTLLY-SLNSCVNPWIYLAF 322 >AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxidase subunit 1 protein. Length = 682 Score = 22.2 bits (45), Expect = 2.9 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = +1 Query: 211 LHHSNWNWCYPKLGA 255 LHH +W+ YP GA Sbjct: 205 LHHWHWHLVYPFEGA 219 >AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase protein. Length = 677 Score = 22.2 bits (45), Expect = 2.9 Identities = 9/30 (30%), Positives = 15/30 (50%) Frame = -2 Query: 331 SIFDEIEVIISQLPKPVLILGDFNAQHQAW 242 S + I + +P P++ L DF + AW Sbjct: 190 SFAESIPPYLFFVPPPLMFLQDFLSHQHAW 219 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 22.2 bits (45), Expect = 2.9 Identities = 9/30 (30%), Positives = 15/30 (50%) Frame = -2 Query: 331 SIFDEIEVIISQLPKPVLILGDFNAQHQAW 242 S + I + +P P++ L DF + AW Sbjct: 423 SFAESIPPYLFFVPPPLMFLQDFLSHQHAW 452 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 22.2 bits (45), Expect = 2.9 Identities = 9/30 (30%), Positives = 15/30 (50%) Frame = -2 Query: 331 SIFDEIEVIISQLPKPVLILGDFNAQHQAW 242 S + I + +P P++ L DF + AW Sbjct: 423 SFAESIPPYLFFVPPPLMFLQDFLSHQHAW 452 >AM292370-1|CAL23182.1| 418|Tribolium castaneum gustatory receptor candidate 49 protein. Length = 418 Score = 21.4 bits (43), Expect = 5.0 Identities = 6/17 (35%), Positives = 11/17 (64%) Frame = -1 Query: 110 IVNHPWLSFLTDLENTF 60 +V+H WL+++ E F Sbjct: 401 MVSHKWLNYINQFEANF 417 >AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxidase subunit 2 protein. Length = 683 Score = 21.0 bits (42), Expect = 6.6 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = +1 Query: 205 IFLHHSNWNWCYP 243 I LHH +W+ YP Sbjct: 203 INLHHWHWHLVYP 215 >DQ855506-1|ABH88193.1| 124|Tribolium castaneum chemosensory protein 20 protein. Length = 124 Score = 20.6 bits (41), Expect = 8.7 Identities = 6/12 (50%), Positives = 8/12 (66%) Frame = -2 Query: 73 WKTLSSTYDSDH 38 WK L + YD +H Sbjct: 100 WKQLEAKYDPEH 111 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 20.6 bits (41), Expect = 8.7 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = +2 Query: 206 YSCTIVTGIGATPSLVLCIKI 268 Y C V GIG+ S V+ I + Sbjct: 773 YLCEAVNGIGSGLSAVIQISV 793 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 20.6 bits (41), Expect = 8.7 Identities = 7/15 (46%), Positives = 9/15 (60%) Frame = -2 Query: 286 PVLILGDFNAQHQAW 242 PV+ L DF + AW Sbjct: 451 PVVFLNDFISHQHAW 465 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 20.6 bits (41), Expect = 8.7 Identities = 7/15 (46%), Positives = 9/15 (60%) Frame = -2 Query: 286 PVLILGDFNAQHQAW 242 PV+ L DF + AW Sbjct: 451 PVVFLNDFISHQHAW 465 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 20.6 bits (41), Expect = 8.7 Identities = 7/15 (46%), Positives = 9/15 (60%) Frame = -2 Query: 286 PVLILGDFNAQHQAW 242 PV+ L DF + AW Sbjct: 451 PVVFLNDFISHQHAW 465 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 20.6 bits (41), Expect = 8.7 Identities = 7/15 (46%), Positives = 9/15 (60%) Frame = -2 Query: 286 PVLILGDFNAQHQAW 242 PV+ L DF + AW Sbjct: 451 PVVFLNDFISHQHAW 465 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 136,795 Number of Sequences: 336 Number of extensions: 3293 Number of successful extensions: 13 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12573240 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -