Bombyx BLAST Result against uniref50

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ovS313A07f
         (521 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q8I5C8 Cluster: Putative uncharacterized protein; n=3; ...    34   2.3  

>UniRef50_Q8I5C8 Cluster: Putative uncharacterized protein; n=3;
            Plasmodium|Rep: Putative uncharacterized protein -
            Plasmodium falciparum (isolate 3D7)
          Length = 1834

 Score = 33.9 bits (74), Expect = 2.3
 Identities = 22/62 (35%), Positives = 35/62 (56%), Gaps = 4/62 (6%)
 Frame = +2

Query: 173  KHFVEYLSNKKIFNVVFFLNE*RVFVLCFFYSL*NY----*YLNCTYKLSKVN*VLLYFN 340
            ++F EY SN  IF ++ F     + V+C+FY+L  Y     +L+  Y+  ++N   LYF 
Sbjct: 1210 ENFNEYYSNYIIFIILKFFENNNIKVICYFYTLLMYCIAKLHLSNNYRFKEIN--YLYF- 1266

Query: 341  LH 346
            LH
Sbjct: 1267 LH 1268


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 426,140,356
Number of Sequences: 1657284
Number of extensions: 7200959
Number of successful extensions: 12464
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 12164
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 12462
length of database: 575,637,011
effective HSP length: 95
effective length of database: 418,195,031
effective search space used: 32619212418
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)