BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS312H11f (521 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_24372| Best HMM Match : Ribosomal_L24e (HMM E-Value=8.5e-40) 133 1e-31 SB_35727| Best HMM Match : Ribosomal_L24e (HMM E-Value=2.1e-07) 93 1e-19 SB_44699| Best HMM Match : Ribosomal_L24e (HMM E-Value=2.2e-07) 90 9e-19 SB_32312| Best HMM Match : Ribosomal_L24e (HMM E-Value=2.2e-07) 90 9e-19 SB_5679| Best HMM Match : Ribosomal_L24e (HMM E-Value=2.2e-07) 90 9e-19 SB_6626| Best HMM Match : Ribosomal_L24e (HMM E-Value=2.2e-07) 90 9e-19 SB_41736| Best HMM Match : Ribosomal_L24e (HMM E-Value=3.2e-07) 88 5e-18 SB_49067| Best HMM Match : Ribosomal_L24e (HMM E-Value=8.8e-07) 87 8e-18 SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 2e-09 SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 2e-09 SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) 59 2e-09 SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 2e-09 SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) 59 2e-09 SB_510| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 2e-09 SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 2e-09 SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40) 59 2e-09 SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 2e-09 SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 2e-09 SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) 59 2e-09 SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 2e-09 SB_4159| Best HMM Match : Vpu (HMM E-Value=2) 59 2e-09 SB_12571| Best HMM Match : SBF (HMM E-Value=1.6e-37) 52 2e-07 SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 2e-07 SB_37618| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 5e-07 SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) 50 2e-06 SB_49172| Best HMM Match : UCR_TM (HMM E-Value=9.8) 50 2e-06 SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 6e-06 SB_51122| Best HMM Match : UCR_TM (HMM E-Value=5.5) 46 3e-05 SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 3e-05 SB_31506| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 2e-04 SB_25896| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 2e-04 SB_46058| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 2e-04 SB_45641| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 2e-04 SB_38028| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 2e-04 SB_14784| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 2e-04 SB_14409| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 2e-04 SB_14212| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 2e-04 SB_6530| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 2e-04 SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2) 42 2e-04 SB_1689| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 2e-04 SB_28728| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_8267| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.015 SB_12479| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.020 SB_11515| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.020 SB_16994| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.035 SB_53034| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.11 SB_32211| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.11 SB_16375| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.11 SB_1214| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.11 SB_58792| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.25 SB_55579| Best HMM Match : Rhodanese (HMM E-Value=9.2e-29) 32 0.25 SB_50054| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.25 SB_49806| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.25 SB_47433| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.25 SB_47291| Best HMM Match : PilN (HMM E-Value=0.75) 32 0.25 SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) 32 0.25 SB_42949| Best HMM Match : SRCR (HMM E-Value=1.6e-14) 32 0.25 SB_41613| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.25 SB_40068| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 32 0.25 SB_36207| Best HMM Match : 7kD_coat (HMM E-Value=7.6) 32 0.25 SB_31511| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.25 SB_27897| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.25 SB_27010| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.25 SB_26995| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.25 SB_20900| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.25 SB_20814| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.25 SB_15447| Best HMM Match : C1_1 (HMM E-Value=0.11) 32 0.25 SB_14175| Best HMM Match : GBP_repeat (HMM E-Value=3.8) 32 0.25 SB_8424| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.25 SB_56358| Best HMM Match : Fork_head (HMM E-Value=1.2e-30) 32 0.25 SB_56058| Best HMM Match : Phasin (HMM E-Value=2.7) 32 0.25 SB_52523| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.25 SB_48632| Best HMM Match : DUF265 (HMM E-Value=7.6e-22) 32 0.25 SB_46830| Best HMM Match : Succ_DH_flav_C (HMM E-Value=3.2e-37) 32 0.25 SB_42128| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.25 SB_40139| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.25 SB_39391| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.25 SB_36396| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.25 SB_31293| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.25 SB_30699| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.25 SB_29464| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.25 SB_25673| Best HMM Match : MFS_1 (HMM E-Value=0.18) 32 0.25 SB_24724| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.25 SB_23954| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.25 SB_17919| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.25 SB_17049| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.25 SB_15972| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.25 SB_12580| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.25 SB_11401| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.25 SB_10689| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.25 SB_9250| Best HMM Match : BAG (HMM E-Value=6.2) 32 0.25 SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.44 SB_36424| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.76 SB_6796| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.76 SB_24804| Best HMM Match : NDUF_B7 (HMM E-Value=4.5) 31 0.76 SB_48986| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_29113| Best HMM Match : RVT_1 (HMM E-Value=0.0066) 30 1.0 SB_28860| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_59802| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_59119| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_58967| Best HMM Match : Sec23_BS (HMM E-Value=5.9) 29 3.1 SB_58852| Best HMM Match : Hormone_4 (HMM E-Value=2.8) 29 3.1 SB_58713| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_58195| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_58029| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_56603| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_56369| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_55830| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_54985| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_54503| Best HMM Match : DUF753 (HMM E-Value=4.7) 29 3.1 SB_53675| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_53669| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_53077| Best HMM Match : SRP54_N (HMM E-Value=1.8) 29 3.1 SB_52837| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_51967| Best HMM Match : Wzy_C (HMM E-Value=7.3) 29 3.1 SB_50928| Best HMM Match : 7tm_2 (HMM E-Value=4.7e-07) 29 3.1 SB_50489| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_50209| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_50159| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_48895| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_48885| Best HMM Match : DUF741 (HMM E-Value=0.88) 29 3.1 SB_48422| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_47991| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_47859| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_46080| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_45570| Best HMM Match : Euplotes_phero (HMM E-Value=2.6) 29 3.1 SB_45449| Best HMM Match : Glyco_hydro_47 (HMM E-Value=1.4e-07) 29 3.1 SB_43819| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_42593| Best HMM Match : Rho_GDI (HMM E-Value=3.7e-17) 29 3.1 SB_42373| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_42112| Best HMM Match : Herpes_UL49_2 (HMM E-Value=1.5) 29 3.1 SB_41202| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_41136| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_41068| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_40980| Best HMM Match : ANF_receptor (HMM E-Value=0.00014) 29 3.1 SB_40764| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_40601| Best HMM Match : VWA_CoxE (HMM E-Value=6.3) 29 3.1 SB_40576| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_40463| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_40182| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_40003| Best HMM Match : YTV (HMM E-Value=8.9) 29 3.1 SB_39444| Best HMM Match : SAC3_GANP (HMM E-Value=0.68) 29 3.1 SB_38813| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_38774| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_38425| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_38203| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_37771| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_36681| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_36014| Best HMM Match : DUF437 (HMM E-Value=6.4) 29 3.1 SB_35849| Best HMM Match : Fibrinogen_C (HMM E-Value=0.15) 29 3.1 SB_35317| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_35151| Best HMM Match : DUF589 (HMM E-Value=7.5) 29 3.1 SB_34685| Best HMM Match : RNA_pol_A_bac (HMM E-Value=1.8) 29 3.1 SB_34478| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_31889| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_30142| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_29043| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_28650| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_28487| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_28424| Best HMM Match : SAM_1 (HMM E-Value=8e-06) 29 3.1 SB_28245| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_27137| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_27095| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_26954| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_26672| Best HMM Match : Exo_endo_phos (HMM E-Value=0.46) 29 3.1 SB_26607| Best HMM Match : K_tetra (HMM E-Value=3.3e-08) 29 3.1 SB_25727| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_25469| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_25193| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_24322| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_23294| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_23196| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_23195| Best HMM Match : zf-C3HC4 (HMM E-Value=1.3e-10) 29 3.1 SB_22108| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_21853| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_21523| Best HMM Match : Pkinase (HMM E-Value=9.5e-14) 29 3.1 SB_20847| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_20629| Best HMM Match : WD40 (HMM E-Value=0.0014) 29 3.1 SB_18983| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_18796| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_18538| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_18411| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_18318| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_18158| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_17237| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_15818| Best HMM Match : Apo-VLDL-II (HMM E-Value=1.2) 29 3.1 SB_15375| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_14672| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_14518| Best HMM Match : MIB_HERC2 (HMM E-Value=2.4e-38) 29 3.1 SB_14044| Best HMM Match : EGF_CA (HMM E-Value=4.1e-13) 29 3.1 SB_13919| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_13475| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_13295| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_13049| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_12559| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_12016| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_11991| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_11294| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_10976| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_10247| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_9391| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_9055| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_8565| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_8222| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_8126| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_7261| Best HMM Match : RHS (HMM E-Value=5.3) 29 3.1 SB_7005| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_6339| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_6047| Best HMM Match : CXC (HMM E-Value=7.7) 29 3.1 SB_5753| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_5503| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_5427| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_4286| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_4268| Best HMM Match : MtrG (HMM E-Value=1.2) 29 3.1 SB_4192| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_3720| Best HMM Match : RVT_1 (HMM E-Value=0.0031) 29 3.1 SB_3671| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_2384| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_1609| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_751| Best HMM Match : rve (HMM E-Value=7.5e-12) 29 3.1 SB_266| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_59| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_58440| Best HMM Match : Ribosomal_L9_C (HMM E-Value=0.81) 29 3.1 SB_58394| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_57506| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_57021| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_56970| Best HMM Match : Thaumatin (HMM E-Value=5.4) 29 3.1 SB_56955| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_56767| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_56729| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_56672| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_56555| Best HMM Match : 7tm_1 (HMM E-Value=4.4) 29 3.1 SB_56099| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_55954| Best HMM Match : TIL (HMM E-Value=0.74) 29 3.1 SB_55138| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_55112| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_54421| Best HMM Match : HipA_C (HMM E-Value=7.5) 29 3.1 SB_54343| Best HMM Match : TipAS (HMM E-Value=0.77) 29 3.1 SB_54153| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_54005| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_53974| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_53662| Best HMM Match : Protamine_P2 (HMM E-Value=9.2) 29 3.1 SB_53598| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_53044| Best HMM Match : TcpA (HMM E-Value=3.1) 29 3.1 SB_52956| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_51739| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_51732| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_51109| Best HMM Match : ATP-cone (HMM E-Value=0.76) 29 3.1 SB_50972| Best HMM Match : MH1 (HMM E-Value=7.1) 29 3.1 SB_50818| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_50491| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_50286| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_50222| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_50081| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_50019| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_49981| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_49899| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_49895| Best HMM Match : NACHT (HMM E-Value=7.7) 29 3.1 SB_49629| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_47940| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_47474| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_47304| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_47265| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_47031| Best HMM Match : Protamine_P1 (HMM E-Value=7) 29 3.1 SB_46862| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_46484| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_46118| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_45749| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_45575| Best HMM Match : Keratin_B2 (HMM E-Value=8.8) 29 3.1 SB_45266| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_44239| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_44171| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_44073| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_43825| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_43752| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_43722| Best HMM Match : TPR_4 (HMM E-Value=0.69) 29 3.1 SB_42847| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_42555| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_42300| Best HMM Match : Filament_head (HMM E-Value=4.9) 29 3.1 SB_42133| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_41545| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_41358| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_41085| Best HMM Match : Auxin_repressed (HMM E-Value=9) 29 3.1 SB_40884| Best HMM Match : Homeobox (HMM E-Value=0.068) 29 3.1 SB_40300| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_39508| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 29 3.1 SB_39208| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_38658| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_38558| Best HMM Match : TFIIA_gamma_N (HMM E-Value=7.4) 29 3.1 SB_38521| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_38282| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_38080| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_37703| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_37072| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_36830| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_36723| Best HMM Match : DUF753 (HMM E-Value=9.9) 29 3.1 SB_36604| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_36374| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_35614| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_35131| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_34873| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_34844| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_34424| Best HMM Match : RNase_U2 (HMM E-Value=7.5) 29 3.1 SB_34216| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_34007| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_33833| Best HMM Match : DUF947 (HMM E-Value=0.2) 29 3.1 SB_33422| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_33231| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_32900| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_32024| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_31980| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_31865| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_31592| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_31481| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_31350| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_30835| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_30521| Best HMM Match : DUF333 (HMM E-Value=9.4) 29 3.1 SB_30479| Best HMM Match : WD40 (HMM E-Value=1.1e-06) 29 3.1 SB_30218| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_29851| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_29553| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_29409| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_29177| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_29145| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_28808| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_28480| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_26038| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_25820| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_25742| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_25630| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_24684| Best HMM Match : Phage_rep_O (HMM E-Value=2.3) 29 3.1 SB_24127| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_24102| Best HMM Match : DUF753 (HMM E-Value=9.4) 29 3.1 SB_23875| Best HMM Match : Porin_3 (HMM E-Value=3.22299e-44) 29 3.1 SB_23282| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_22993| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_22914| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_21520| Best HMM Match : Trypsin (HMM E-Value=0) 29 3.1 SB_21177| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_20904| Best HMM Match : Filament_head (HMM E-Value=10) 29 3.1 SB_20277| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_20097| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_19885| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_19009| Best HMM Match : Sperm_Ag_HE2 (HMM E-Value=2.3) 29 3.1 SB_18235| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_17265| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_16846| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_16672| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_16494| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_16270| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_16198| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_16182| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_15539| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_14857| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_14581| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_14087| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_13215| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_12828| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_12518| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_12140| Best HMM Match : ATP-synt_F (HMM E-Value=0.21) 29 3.1 SB_12114| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_11228| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_11209| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_11018| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_10984| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_10523| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_10150| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_9428| Best HMM Match : Vicilin_N (HMM E-Value=4.2) 29 3.1 SB_9090| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_8817| Best HMM Match : I-set (HMM E-Value=0) 29 3.1 SB_8429| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_7590| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_7267| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_6665| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_6263| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_5632| Best HMM Match : XRN_N (HMM E-Value=3.9) 29 3.1 SB_5073| Best HMM Match : Rhomboid (HMM E-Value=3.3) 29 3.1 SB_4702| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_4674| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_4528| Best HMM Match : Antistasin (HMM E-Value=8.4) 29 3.1 SB_4508| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_4402| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_4342| Best HMM Match : KA1 (HMM E-Value=0.53) 29 3.1 SB_2432| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_2348| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_2263| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_1977| Best HMM Match : Filament_head (HMM E-Value=4.2) 29 3.1 SB_1945| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_1808| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_1435| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_1403| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_1283| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_1210| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_1178| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_1099| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_938| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_758| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_357| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_37693| Best HMM Match : PHD (HMM E-Value=8.7e-35) 28 4.1 SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.1 SB_14467| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.1 SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_59460| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_58229| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 27 9.4 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 27 9.4 SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_57634| Best HMM Match : EGF_2 (HMM E-Value=0.0014) 27 9.4 SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_57287| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 27 9.4 SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) 27 9.4 SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) 27 9.4 SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_56465| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_55981| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) 27 9.4 SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) 27 9.4 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) 27 9.4 SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 27 9.4 SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) 27 9.4 SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3) 27 9.4 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) 27 9.4 SB_53988| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_53980| Best HMM Match : UCR_TM (HMM E-Value=9.9) 27 9.4 SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 >SB_24372| Best HMM Match : Ribosomal_L24e (HMM E-Value=8.5e-40) Length = 154 Score = 133 bits (321), Expect = 1e-31 Identities = 62/100 (62%), Positives = 71/100 (71%) Frame = -3 Query: 429 MKIGLCAYSGYKIYPGHGKTMVKVDGKTFTFLNSKCEAAHLMRRNPRKVTWTVLYRRKFK 250 MK+ LC YSGYKIYPGHGK V+ DGK F FLN +CE A LMRRNPR+VTWTVLYRRK K Sbjct: 1 MKLELCNYSGYKIYPGHGKRYVRQDGKVFNFLNKRCERALLMRRNPREVTWTVLYRRKHK 60 Query: 249 KGQEEEXXXXXXXXXXXXXXAIVGASLSDIMAKRNMKPEV 130 KG +EE ++ GASL +I+AKRN KPEV Sbjct: 61 KGTQEEVSKKRTRRNIKFQRSVQGASLDNILAKRNQKPEV 100 >SB_35727| Best HMM Match : Ribosomal_L24e (HMM E-Value=2.1e-07) Length = 139 Score = 93.1 bits (221), Expect = 1e-19 Identities = 44/78 (56%), Positives = 52/78 (66%) Frame = -3 Query: 363 KVDGKTFTFLNSKCEAAHLMRRNPRKVTWTVLYRRKFKKGQEEEXXXXXXXXXXXXXXAI 184 K GK F +LN +CE A LMRRNPR+VTWTVLYRRK KKG +EE ++ Sbjct: 38 KFQGKVFNYLNKRCERALLMRRNPREVTWTVLYRRKHKKGTQEEVSKKRTRRNIKFQRSV 97 Query: 183 VGASLSDIMAKRNMKPEV 130 GASL +I+AKRN KPEV Sbjct: 98 QGASLDNILAKRNQKPEV 115 >SB_44699| Best HMM Match : Ribosomal_L24e (HMM E-Value=2.2e-07) Length = 113 Score = 90.2 bits (214), Expect = 9e-19 Identities = 43/74 (58%), Positives = 50/74 (67%) Frame = -3 Query: 351 KTFTFLNSKCEAAHLMRRNPRKVTWTVLYRRKFKKGQEEEXXXXXXXXXXXXXXAIVGAS 172 K F FLN +CE A LMRRNPR+VTWTVLYRRK KKG +EE ++ GAS Sbjct: 7 KVFNFLNKRCERALLMRRNPREVTWTVLYRRKHKKGTQEEVSKKRTRRNIKFQRSVQGAS 66 Query: 171 LSDIMAKRNMKPEV 130 L +I+AKRN KPEV Sbjct: 67 LDNILAKRNQKPEV 80 >SB_32312| Best HMM Match : Ribosomal_L24e (HMM E-Value=2.2e-07) Length = 90 Score = 90.2 bits (214), Expect = 9e-19 Identities = 43/74 (58%), Positives = 50/74 (67%) Frame = -3 Query: 351 KTFTFLNSKCEAAHLMRRNPRKVTWTVLYRRKFKKGQEEEXXXXXXXXXXXXXXAIVGAS 172 K F FLN +CE A LMRRNPR+VTWTVLYRRK KKG +EE ++ GAS Sbjct: 7 KVFNFLNKRCERALLMRRNPREVTWTVLYRRKHKKGTQEEVSKKRTRRNIKFQRSVQGAS 66 Query: 171 LSDIMAKRNMKPEV 130 L +I+AKRN KPEV Sbjct: 67 LDNILAKRNQKPEV 80 >SB_5679| Best HMM Match : Ribosomal_L24e (HMM E-Value=2.2e-07) Length = 90 Score = 90.2 bits (214), Expect = 9e-19 Identities = 43/74 (58%), Positives = 50/74 (67%) Frame = -3 Query: 351 KTFTFLNSKCEAAHLMRRNPRKVTWTVLYRRKFKKGQEEEXXXXXXXXXXXXXXAIVGAS 172 K F FLN +CE A LMRRNPR+VTWTVLYRRK KKG +EE ++ GAS Sbjct: 7 KVFNFLNKRCERALLMRRNPREVTWTVLYRRKHKKGTQEEVSKKRTRRNIKFQRSVQGAS 66 Query: 171 LSDIMAKRNMKPEV 130 L +I+AKRN KPEV Sbjct: 67 LDNILAKRNQKPEV 80 >SB_6626| Best HMM Match : Ribosomal_L24e (HMM E-Value=2.2e-07) Length = 90 Score = 90.2 bits (214), Expect = 9e-19 Identities = 43/74 (58%), Positives = 50/74 (67%) Frame = -3 Query: 351 KTFTFLNSKCEAAHLMRRNPRKVTWTVLYRRKFKKGQEEEXXXXXXXXXXXXXXAIVGAS 172 K F FLN +CE A LMRRNPR+VTWTVLYRRK KKG +EE ++ GAS Sbjct: 7 KVFNFLNKRCERALLMRRNPREVTWTVLYRRKHKKGTQEEVSKKRTRRNIKFQRSVQGAS 66 Query: 171 LSDIMAKRNMKPEV 130 L +I+AKRN KPEV Sbjct: 67 LDNILAKRNQKPEV 80 >SB_41736| Best HMM Match : Ribosomal_L24e (HMM E-Value=3.2e-07) Length = 104 Score = 87.8 bits (208), Expect = 5e-18 Identities = 42/74 (56%), Positives = 49/74 (66%) Frame = -3 Query: 351 KTFTFLNSKCEAAHLMRRNPRKVTWTVLYRRKFKKGQEEEXXXXXXXXXXXXXXAIVGAS 172 K F FLN +CE A LMRRNPR+VTWTVLYRR KKG +EE ++ GAS Sbjct: 7 KVFNFLNKRCERALLMRRNPREVTWTVLYRRMHKKGTQEEVSKKRTRRNIKFQRSVQGAS 66 Query: 171 LSDIMAKRNMKPEV 130 L +I+AKRN KPEV Sbjct: 67 LDNILAKRNQKPEV 80 >SB_49067| Best HMM Match : Ribosomal_L24e (HMM E-Value=8.8e-07) Length = 90 Score = 87.0 bits (206), Expect = 8e-18 Identities = 42/74 (56%), Positives = 49/74 (66%) Frame = -3 Query: 351 KTFTFLNSKCEAAHLMRRNPRKVTWTVLYRRKFKKGQEEEXXXXXXXXXXXXXXAIVGAS 172 K F FLN +CE A LMRRNPR+VTWTVLYR K KKG +EE ++ GAS Sbjct: 7 KVFNFLNKRCERALLMRRNPREVTWTVLYRCKHKKGTQEEVSKKRTRRNIKFQRSVQGAS 66 Query: 171 LSDIMAKRNMKPEV 130 L +I+AKRN KPEV Sbjct: 67 LDNILAKRNQKPEV 80 >SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 408 Score = 59.3 bits (137), Expect = 2e-09 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = -1 Query: 518 FPSHDVVKRRPVNCNTTHYRANW 450 FPSHDVVKRRPVNCNTTHYRANW Sbjct: 2 FPSHDVVKRRPVNCNTTHYRANW 24 >SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 287 Score = 59.3 bits (137), Expect = 2e-09 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = -1 Query: 518 FPSHDVVKRRPVNCNTTHYRANW 450 FPSHDVVKRRPVNCNTTHYRANW Sbjct: 58 FPSHDVVKRRPVNCNTTHYRANW 80 >SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) Length = 2506 Score = 59.3 bits (137), Expect = 2e-09 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = -1 Query: 518 FPSHDVVKRRPVNCNTTHYRANW 450 FPSHDVVKRRPVNCNTTHYRANW Sbjct: 626 FPSHDVVKRRPVNCNTTHYRANW 648 >SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 59.3 bits (137), Expect = 2e-09 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = -1 Query: 518 FPSHDVVKRRPVNCNTTHYRANW 450 FPSHDVVKRRPVNCNTTHYRANW Sbjct: 37 FPSHDVVKRRPVNCNTTHYRANW 59 >SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) Length = 117 Score = 59.3 bits (137), Expect = 2e-09 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = -1 Query: 518 FPSHDVVKRRPVNCNTTHYRANW 450 FPSHDVVKRRPVNCNTTHYRANW Sbjct: 39 FPSHDVVKRRPVNCNTTHYRANW 61 >SB_510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1907 Score = 59.3 bits (137), Expect = 2e-09 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = -1 Query: 518 FPSHDVVKRRPVNCNTTHYRANW 450 FPSHDVVKRRPVNCNTTHYRANW Sbjct: 1877 FPSHDVVKRRPVNCNTTHYRANW 1899 >SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 59.3 bits (137), Expect = 2e-09 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = -1 Query: 518 FPSHDVVKRRPVNCNTTHYRANW 450 FPSHDVVKRRPVNCNTTHYRANW Sbjct: 37 FPSHDVVKRRPVNCNTTHYRANW 59 >SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40) Length = 768 Score = 59.3 bits (137), Expect = 2e-09 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = -1 Query: 518 FPSHDVVKRRPVNCNTTHYRANW 450 FPSHDVVKRRPVNCNTTHYRANW Sbjct: 31 FPSHDVVKRRPVNCNTTHYRANW 53 >SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 602 Score = 59.3 bits (137), Expect = 2e-09 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = -1 Query: 518 FPSHDVVKRRPVNCNTTHYRANW 450 FPSHDVVKRRPVNCNTTHYRANW Sbjct: 80 FPSHDVVKRRPVNCNTTHYRANW 102 >SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 59.3 bits (137), Expect = 2e-09 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = -1 Query: 518 FPSHDVVKRRPVNCNTTHYRANW 450 FPSHDVVKRRPVNCNTTHYRANW Sbjct: 58 FPSHDVVKRRPVNCNTTHYRANW 80 >SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) Length = 281 Score = 59.3 bits (137), Expect = 2e-09 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = -1 Query: 518 FPSHDVVKRRPVNCNTTHYRANW 450 FPSHDVVKRRPVNCNTTHYRANW Sbjct: 69 FPSHDVVKRRPVNCNTTHYRANW 91 >SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 59.3 bits (137), Expect = 2e-09 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = -1 Query: 518 FPSHDVVKRRPVNCNTTHYRANW 450 FPSHDVVKRRPVNCNTTHYRANW Sbjct: 45 FPSHDVVKRRPVNCNTTHYRANW 67 >SB_4159| Best HMM Match : Vpu (HMM E-Value=2) Length = 779 Score = 59.3 bits (137), Expect = 2e-09 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = -1 Query: 518 FPSHDVVKRRPVNCNTTHYRANW 450 FPSHDVVKRRPVNCNTTHYRANW Sbjct: 69 FPSHDVVKRRPVNCNTTHYRANW 91 >SB_12571| Best HMM Match : SBF (HMM E-Value=1.6e-37) Length = 257 Score = 52.4 bits (120), Expect = 2e-07 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -1 Query: 509 HDVVKRRPVNCNTTHYRANW 450 HDVVKRRPVNCNTTHYRANW Sbjct: 2 HDVVKRRPVNCNTTHYRANW 21 >SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 52.4 bits (120), Expect = 2e-07 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -1 Query: 509 HDVVKRRPVNCNTTHYRANW 450 HDVVKRRPVNCNTTHYRANW Sbjct: 2 HDVVKRRPVNCNTTHYRANW 21 >SB_37618| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 51.2 bits (117), Expect = 5e-07 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = -1 Query: 518 FPSHDVVKRRPVNCNTTHYRAN 453 F SHDVVKRRPVNCNTTHYRAN Sbjct: 19 FRSHDVVKRRPVNCNTTHYRAN 40 >SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 237 Score = 49.6 bits (113), Expect = 2e-06 Identities = 20/22 (90%), Positives = 20/22 (90%) Frame = -1 Query: 518 FPSHDVVKRRPVNCNTTHYRAN 453 FPSHD KRRPVNCNTTHYRAN Sbjct: 76 FPSHDGEKRRPVNCNTTHYRAN 97 >SB_49172| Best HMM Match : UCR_TM (HMM E-Value=9.8) Length = 142 Score = 49.6 bits (113), Expect = 2e-06 Identities = 20/23 (86%), Positives = 21/23 (91%) Frame = +3 Query: 450 PIRPIVSRITIHWPSFYNVVTGK 518 PIRPIVSRITIHWP+FYN TGK Sbjct: 39 PIRPIVSRITIHWPAFYNAPTGK 61 >SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 47.6 bits (108), Expect = 6e-06 Identities = 19/22 (86%), Positives = 21/22 (95%) Frame = +3 Query: 453 IRPIVSRITIHWPSFYNVVTGK 518 +RP+VSRITIHW SFYNVVTGK Sbjct: 33 LRPVVSRITIHWTSFYNVVTGK 54 >SB_51122| Best HMM Match : UCR_TM (HMM E-Value=5.5) Length = 131 Score = 45.6 bits (103), Expect = 3e-05 Identities = 19/21 (90%), Positives = 19/21 (90%) Frame = +3 Query: 450 PIRPIVSRITIHWPSFYNVVT 512 PIRPIVS ITIHWPSFYN VT Sbjct: 41 PIRPIVSHITIHWPSFYNGVT 61 >SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 45.2 bits (102), Expect = 3e-05 Identities = 18/20 (90%), Positives = 19/20 (95%) Frame = +3 Query: 459 PIVSRITIHWPSFYNVVTGK 518 P +SRITIHWPSFYNVVTGK Sbjct: 77 PYMSRITIHWPSFYNVVTGK 96 >SB_31506| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 42.3 bits (95), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +3 Query: 468 SRITIHWPSFYNVVTGK 518 SRITIHWPSFYNVVTGK Sbjct: 2 SRITIHWPSFYNVVTGK 18 >SB_25896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 42.3 bits (95), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +3 Query: 468 SRITIHWPSFYNVVTGK 518 SRITIHWPSFYNVVTGK Sbjct: 2 SRITIHWPSFYNVVTGK 18 >SB_46058| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 42.3 bits (95), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +3 Query: 468 SRITIHWPSFYNVVTGK 518 SRITIHWPSFYNVVTGK Sbjct: 2 SRITIHWPSFYNVVTGK 18 >SB_45641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 42.3 bits (95), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +3 Query: 468 SRITIHWPSFYNVVTGK 518 SRITIHWPSFYNVVTGK Sbjct: 2 SRITIHWPSFYNVVTGK 18 >SB_38028| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 42.3 bits (95), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +3 Query: 468 SRITIHWPSFYNVVTGK 518 SRITIHWPSFYNVVTGK Sbjct: 2 SRITIHWPSFYNVVTGK 18 >SB_14784| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 42.3 bits (95), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +3 Query: 468 SRITIHWPSFYNVVTGK 518 SRITIHWPSFYNVVTGK Sbjct: 2 SRITIHWPSFYNVVTGK 18 >SB_14409| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 100 Score = 42.3 bits (95), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +3 Query: 468 SRITIHWPSFYNVVTGK 518 SRITIHWPSFYNVVTGK Sbjct: 2 SRITIHWPSFYNVVTGK 18 >SB_14212| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 42.3 bits (95), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +3 Query: 468 SRITIHWPSFYNVVTGK 518 SRITIHWPSFYNVVTGK Sbjct: 2 SRITIHWPSFYNVVTGK 18 >SB_6530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 42.3 bits (95), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +3 Query: 468 SRITIHWPSFYNVVTGK 518 SRITIHWPSFYNVVTGK Sbjct: 2 SRITIHWPSFYNVVTGK 18 >SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2) Length = 98 Score = 42.3 bits (95), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +3 Query: 468 SRITIHWPSFYNVVTGK 518 SRITIHWPSFYNVVTGK Sbjct: 2 SRITIHWPSFYNVVTGK 18 >SB_1689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 42.3 bits (95), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +3 Query: 468 SRITIHWPSFYNVVTGK 518 SRITIHWPSFYNVVTGK Sbjct: 2 SRITIHWPSFYNVVTGK 18 >SB_28728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 39.9 bits (89), Expect = 0.001 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 453 IRPIVSRITIHWPSFY 500 IRPIVSRITIHWPSFY Sbjct: 18 IRPIVSRITIHWPSFY 33 >SB_8267| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 36.3 bits (80), Expect = 0.015 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 468 SRITIHWPSFYNVVTGK 518 SRITIHWPSFYNV+ K Sbjct: 2 SRITIHWPSFYNVMLAK 18 >SB_12479| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 52 Score = 35.9 bits (79), Expect = 0.020 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = -3 Query: 252 KKGQEEEXXXXXXXXXXXXXXAIVGASLSDIMAKRNMKPEV 130 KKG +EE ++ GASL +I+AKRN KPEV Sbjct: 2 KKGTQEEVSKKRTRRNIKFQRSVQGASLDNILAKRNQKPEV 42 >SB_11515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 35.9 bits (79), Expect = 0.020 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = +3 Query: 468 SRITIHWPSFYNVV 509 SRITIHWPSFYNVV Sbjct: 2 SRITIHWPSFYNVV 15 >SB_16994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 35.1 bits (77), Expect = 0.035 Identities = 18/36 (50%), Positives = 24/36 (66%) Frame = -1 Query: 518 FPSHDVVKRRPVNCNTTHYRANWVPXPPSK*RSDFA 411 FPSHDVVKRRPV + H + + PP+K +DF+ Sbjct: 14 FPSHDVVKRRPV--PSLHACRSTLEDPPNKIFNDFS 47 >SB_53034| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 33.5 bits (73), Expect = 0.11 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = +3 Query: 483 HWPSFYNVVTGK 518 HWPSFYNVVTGK Sbjct: 5 HWPSFYNVVTGK 16 >SB_32211| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 109 Score = 33.5 bits (73), Expect = 0.11 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = +3 Query: 483 HWPSFYNVVTGK 518 HWPSFYNVVTGK Sbjct: 62 HWPSFYNVVTGK 73 >SB_16375| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 33.5 bits (73), Expect = 0.11 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = +3 Query: 483 HWPSFYNVVTGK 518 HWPSFYNVVTGK Sbjct: 5 HWPSFYNVVTGK 16 >SB_1214| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 33.5 bits (73), Expect = 0.11 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = +3 Query: 483 HWPSFYNVVTGK 518 HWPSFYNVVTGK Sbjct: 57 HWPSFYNVVTGK 68 >SB_58792| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 32.3 bits (70), Expect = 0.25 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -3 Query: 519 FSQSRRCKTTASEL 478 FSQSRRCKTTASEL Sbjct: 44 FSQSRRCKTTASEL 57 >SB_55579| Best HMM Match : Rhodanese (HMM E-Value=9.2e-29) Length = 269 Score = 32.3 bits (70), Expect = 0.25 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -3 Query: 519 FSQSRRCKTTASEL 478 FSQSRRCKTTASEL Sbjct: 256 FSQSRRCKTTASEL 269 >SB_50054| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 937 Score = 32.3 bits (70), Expect = 0.25 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -3 Query: 519 FSQSRRCKTTASEL 478 FSQSRRCKTTASEL Sbjct: 924 FSQSRRCKTTASEL 937 >SB_49806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 32.3 bits (70), Expect = 0.25 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -3 Query: 519 FSQSRRCKTTASEL 478 FSQSRRCKTTASEL Sbjct: 37 FSQSRRCKTTASEL 50 >SB_47433| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 49 Score = 32.3 bits (70), Expect = 0.25 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -3 Query: 519 FSQSRRCKTTASEL 478 FSQSRRCKTTASEL Sbjct: 36 FSQSRRCKTTASEL 49 >SB_47291| Best HMM Match : PilN (HMM E-Value=0.75) Length = 424 Score = 32.3 bits (70), Expect = 0.25 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -3 Query: 519 FSQSRRCKTTASEL 478 FSQSRRCKTTASEL Sbjct: 411 FSQSRRCKTTASEL 424 >SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) Length = 273 Score = 32.3 bits (70), Expect = 0.25 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -3 Query: 519 FSQSRRCKTTASEL 478 FSQSRRCKTTASEL Sbjct: 260 FSQSRRCKTTASEL 273 >SB_42949| Best HMM Match : SRCR (HMM E-Value=1.6e-14) Length = 340 Score = 32.3 bits (70), Expect = 0.25 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -3 Query: 519 FSQSRRCKTTASEL 478 FSQSRRCKTTASEL Sbjct: 327 FSQSRRCKTTASEL 340 >SB_41613| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 49 Score = 32.3 bits (70), Expect = 0.25 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -3 Query: 519 FSQSRRCKTTASEL 478 FSQSRRCKTTASEL Sbjct: 36 FSQSRRCKTTASEL 49 >SB_40068| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 406 Score = 32.3 bits (70), Expect = 0.25 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -3 Query: 519 FSQSRRCKTTASEL 478 FSQSRRCKTTASEL Sbjct: 393 FSQSRRCKTTASEL 406 >SB_36207| Best HMM Match : 7kD_coat (HMM E-Value=7.6) Length = 98 Score = 32.3 bits (70), Expect = 0.25 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -3 Query: 519 FSQSRRCKTTASEL 478 FSQSRRCKTTASEL Sbjct: 85 FSQSRRCKTTASEL 98 >SB_31511| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 372 Score = 32.3 bits (70), Expect = 0.25 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -3 Query: 519 FSQSRRCKTTASEL 478 FSQSRRCKTTASEL Sbjct: 44 FSQSRRCKTTASEL 57 >SB_27897| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 32.3 bits (70), Expect = 0.25 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -3 Query: 519 FSQSRRCKTTASEL 478 FSQSRRCKTTASEL Sbjct: 37 FSQSRRCKTTASEL 50 >SB_27010| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 32.3 bits (70), Expect = 0.25 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -3 Query: 519 FSQSRRCKTTASEL 478 FSQSRRCKTTASEL Sbjct: 37 FSQSRRCKTTASEL 50 >SB_26995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 32.3 bits (70), Expect = 0.25 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -3 Query: 519 FSQSRRCKTTASEL 478 FSQSRRCKTTASEL Sbjct: 44 FSQSRRCKTTASEL 57 >SB_20900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 32.3 bits (70), Expect = 0.25 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -3 Query: 519 FSQSRRCKTTASEL 478 FSQSRRCKTTASEL Sbjct: 44 FSQSRRCKTTASEL 57 >SB_20814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 32.3 bits (70), Expect = 0.25 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -3 Query: 519 FSQSRRCKTTASEL 478 FSQSRRCKTTASEL Sbjct: 67 FSQSRRCKTTASEL 80 >SB_15447| Best HMM Match : C1_1 (HMM E-Value=0.11) Length = 316 Score = 32.3 bits (70), Expect = 0.25 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -3 Query: 519 FSQSRRCKTTASEL 478 FSQSRRCKTTASEL Sbjct: 303 FSQSRRCKTTASEL 316 >SB_14175| Best HMM Match : GBP_repeat (HMM E-Value=3.8) Length = 300 Score = 32.3 bits (70), Expect = 0.25 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -3 Query: 519 FSQSRRCKTTASEL 478 FSQSRRCKTTASEL Sbjct: 287 FSQSRRCKTTASEL 300 >SB_8424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 32.3 bits (70), Expect = 0.25 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -3 Query: 519 FSQSRRCKTTASEL 478 FSQSRRCKTTASEL Sbjct: 37 FSQSRRCKTTASEL 50 >SB_56358| Best HMM Match : Fork_head (HMM E-Value=1.2e-30) Length = 289 Score = 32.3 bits (70), Expect = 0.25 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -3 Query: 519 FSQSRRCKTTASEL 478 FSQSRRCKTTASEL Sbjct: 276 FSQSRRCKTTASEL 289 >SB_56058| Best HMM Match : Phasin (HMM E-Value=2.7) Length = 314 Score = 32.3 bits (70), Expect = 0.25 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -3 Query: 519 FSQSRRCKTTASEL 478 FSQSRRCKTTASEL Sbjct: 301 FSQSRRCKTTASEL 314 >SB_52523| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 498 Score = 32.3 bits (70), Expect = 0.25 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -3 Query: 519 FSQSRRCKTTASEL 478 FSQSRRCKTTASEL Sbjct: 485 FSQSRRCKTTASEL 498 >SB_48632| Best HMM Match : DUF265 (HMM E-Value=7.6e-22) Length = 455 Score = 32.3 bits (70), Expect = 0.25 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -3 Query: 519 FSQSRRCKTTASEL 478 FSQSRRCKTTASEL Sbjct: 154 FSQSRRCKTTASEL 167 >SB_46830| Best HMM Match : Succ_DH_flav_C (HMM E-Value=3.2e-37) Length = 333 Score = 32.3 bits (70), Expect = 0.25 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -3 Query: 519 FSQSRRCKTTASEL 478 FSQSRRCKTTASEL Sbjct: 320 FSQSRRCKTTASEL 333 >SB_42128| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 32.3 bits (70), Expect = 0.25 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -3 Query: 519 FSQSRRCKTTASEL 478 FSQSRRCKTTASEL Sbjct: 170 FSQSRRCKTTASEL 183 >SB_40139| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 32.3 bits (70), Expect = 0.25 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -3 Query: 519 FSQSRRCKTTASEL 478 FSQSRRCKTTASEL Sbjct: 44 FSQSRRCKTTASEL 57 >SB_39391| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 376 Score = 32.3 bits (70), Expect = 0.25 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -3 Query: 519 FSQSRRCKTTASEL 478 FSQSRRCKTTASEL Sbjct: 363 FSQSRRCKTTASEL 376 >SB_36396| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 32.3 bits (70), Expect = 0.25 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -3 Query: 519 FSQSRRCKTTASEL 478 FSQSRRCKTTASEL Sbjct: 37 FSQSRRCKTTASEL 50 >SB_31293| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 32.3 bits (70), Expect = 0.25 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -3 Query: 519 FSQSRRCKTTASEL 478 FSQSRRCKTTASEL Sbjct: 44 FSQSRRCKTTASEL 57 >SB_30699| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 43 Score = 32.3 bits (70), Expect = 0.25 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -3 Query: 519 FSQSRRCKTTASEL 478 FSQSRRCKTTASEL Sbjct: 30 FSQSRRCKTTASEL 43 >SB_29464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 242 Score = 32.3 bits (70), Expect = 0.25 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -3 Query: 519 FSQSRRCKTTASEL 478 FSQSRRCKTTASEL Sbjct: 229 FSQSRRCKTTASEL 242 >SB_25673| Best HMM Match : MFS_1 (HMM E-Value=0.18) Length = 634 Score = 32.3 bits (70), Expect = 0.25 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -3 Query: 519 FSQSRRCKTTASEL 478 FSQSRRCKTTASEL Sbjct: 621 FSQSRRCKTTASEL 634 >SB_24724| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2021 Score = 32.3 bits (70), Expect = 0.25 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -3 Query: 519 FSQSRRCKTTASEL 478 FSQSRRCKTTASEL Sbjct: 257 FSQSRRCKTTASEL 270 >SB_23954| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 79 Score = 32.3 bits (70), Expect = 0.25 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -3 Query: 519 FSQSRRCKTTASEL 478 FSQSRRCKTTASEL Sbjct: 66 FSQSRRCKTTASEL 79 >SB_17919| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 32.3 bits (70), Expect = 0.25 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -3 Query: 519 FSQSRRCKTTASEL 478 FSQSRRCKTTASEL Sbjct: 97 FSQSRRCKTTASEL 110 >SB_17049| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 548 Score = 32.3 bits (70), Expect = 0.25 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -3 Query: 519 FSQSRRCKTTASEL 478 FSQSRRCKTTASEL Sbjct: 535 FSQSRRCKTTASEL 548 >SB_15972| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 32.3 bits (70), Expect = 0.25 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -3 Query: 519 FSQSRRCKTTASEL 478 FSQSRRCKTTASEL Sbjct: 37 FSQSRRCKTTASEL 50 >SB_12580| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 32.3 bits (70), Expect = 0.25 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -3 Query: 519 FSQSRRCKTTASEL 478 FSQSRRCKTTASEL Sbjct: 118 FSQSRRCKTTASEL 131 >SB_11401| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 439 Score = 32.3 bits (70), Expect = 0.25 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -3 Query: 519 FSQSRRCKTTASEL 478 FSQSRRCKTTASEL Sbjct: 426 FSQSRRCKTTASEL 439 >SB_10689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 43 Score = 32.3 bits (70), Expect = 0.25 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -3 Query: 519 FSQSRRCKTTASEL 478 FSQSRRCKTTASEL Sbjct: 30 FSQSRRCKTTASEL 43 >SB_9250| Best HMM Match : BAG (HMM E-Value=6.2) Length = 232 Score = 32.3 bits (70), Expect = 0.25 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -3 Query: 519 FSQSRRCKTTASEL 478 FSQSRRCKTTASEL Sbjct: 219 FSQSRRCKTTASEL 232 >SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 31.5 bits (68), Expect = 0.44 Identities = 15/19 (78%), Positives = 15/19 (78%) Frame = -3 Query: 519 FSQSRRCKTTASEL*YDSL 463 FSQSRRCKTTASE D L Sbjct: 44 FSQSRRCKTTASEFPGDPL 62 Score = 27.1 bits (57), Expect = 9.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 485 LAVVLQRRDWE 517 LAVVLQRRDWE Sbjct: 85 LAVVLQRRDWE 95 >SB_36424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 49 Score = 30.7 bits (66), Expect = 0.76 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 483 HWPSFYNVVTGK 518 HWPSFYN VTGK Sbjct: 5 HWPSFYNDVTGK 16 >SB_6796| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 925 Score = 30.7 bits (66), Expect = 0.76 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -3 Query: 519 FSQSRRCKTTASE 481 FSQSRRCKTTASE Sbjct: 566 FSQSRRCKTTASE 578 >SB_24804| Best HMM Match : NDUF_B7 (HMM E-Value=4.5) Length = 235 Score = 30.7 bits (66), Expect = 0.76 Identities = 19/55 (34%), Positives = 26/55 (47%) Frame = +2 Query: 353 PSTLTMVLPWPGYILYPL*AQSPIFILRGGPVXXXXXXXXXXXXLAVVLQRRDWE 517 P+ M P+PG YP+ +Q + + + LAVVLQRRDWE Sbjct: 102 PTNNPMFRPFPGRQQYPMNSQQQQ-LEQALKIISECVSESYYNSLAVVLQRRDWE 155 >SB_48986| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 201 Score = 30.3 bits (65), Expect = 1.0 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -1 Query: 518 FPSHDVVKRRPV 483 FPSHDVVKRRPV Sbjct: 56 FPSHDVVKRRPV 67 >SB_29113| Best HMM Match : RVT_1 (HMM E-Value=0.0066) Length = 444 Score = 30.3 bits (65), Expect = 1.0 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -1 Query: 518 FPSHDVVKRRPV 483 FPSHDVVKRRPV Sbjct: 218 FPSHDVVKRRPV 229 >SB_28860| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 30.3 bits (65), Expect = 1.0 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -1 Query: 518 FPSHDVVKRRPV 483 FPSHDVVKRRPV Sbjct: 14 FPSHDVVKRRPV 25 >SB_59802| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3213 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 519 FSQSRRCKTTAS 484 FSQSRRCKTTAS Sbjct: 512 FSQSRRCKTTAS 523 >SB_59119| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 55 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 519 FSQSRRCKTTAS 484 FSQSRRCKTTAS Sbjct: 37 FSQSRRCKTTAS 48 >SB_58967| Best HMM Match : Sec23_BS (HMM E-Value=5.9) Length = 123 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 519 FSQSRRCKTTAS 484 FSQSRRCKTTAS Sbjct: 59 FSQSRRCKTTAS 70 >SB_58852| Best HMM Match : Hormone_4 (HMM E-Value=2.8) Length = 212 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 519 FSQSRRCKTTAS 484 FSQSRRCKTTAS Sbjct: 182 FSQSRRCKTTAS 193 >SB_58713| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 55 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 519 FSQSRRCKTTAS 484 FSQSRRCKTTAS Sbjct: 37 FSQSRRCKTTAS 48 >SB_58195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 519 FSQSRRCKTTAS 484 FSQSRRCKTTAS Sbjct: 37 FSQSRRCKTTAS 48 >SB_58029| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 519 FSQSRRCKTTAS 484 FSQSRRCKTTAS Sbjct: 37 FSQSRRCKTTAS 48 >SB_56603| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 519 FSQSRRCKTTAS 484 FSQSRRCKTTAS Sbjct: 37 FSQSRRCKTTAS 48 >SB_56369| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 328 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 519 FSQSRRCKTTAS 484 FSQSRRCKTTAS Sbjct: 259 FSQSRRCKTTAS 270 >SB_55830| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 431 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 519 FSQSRRCKTTAS 484 FSQSRRCKTTAS Sbjct: 403 FSQSRRCKTTAS 414 >SB_54985| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 519 FSQSRRCKTTAS 484 FSQSRRCKTTAS Sbjct: 37 FSQSRRCKTTAS 48 >SB_54503| Best HMM Match : DUF753 (HMM E-Value=4.7) Length = 141 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 519 FSQSRRCKTTAS 484 FSQSRRCKTTAS Sbjct: 59 FSQSRRCKTTAS 70 >SB_53675| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 519 FSQSRRCKTTAS 484 FSQSRRCKTTAS Sbjct: 37 FSQSRRCKTTAS 48 >SB_53669| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 519 FSQSRRCKTTAS 484 FSQSRRCKTTAS Sbjct: 37 FSQSRRCKTTAS 48 >SB_53077| Best HMM Match : SRP54_N (HMM E-Value=1.8) Length = 533 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 519 FSQSRRCKTTAS 484 FSQSRRCKTTAS Sbjct: 105 FSQSRRCKTTAS 116 >SB_52837| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 519 FSQSRRCKTTAS 484 FSQSRRCKTTAS Sbjct: 37 FSQSRRCKTTAS 48 >SB_51967| Best HMM Match : Wzy_C (HMM E-Value=7.3) Length = 185 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 519 FSQSRRCKTTAS 484 FSQSRRCKTTAS Sbjct: 59 FSQSRRCKTTAS 70 >SB_50928| Best HMM Match : 7tm_2 (HMM E-Value=4.7e-07) Length = 1127 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 519 FSQSRRCKTTAS 484 FSQSRRCKTTAS Sbjct: 686 FSQSRRCKTTAS 697 >SB_50489| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 519 FSQSRRCKTTAS 484 FSQSRRCKTTAS Sbjct: 37 FSQSRRCKTTAS 48 >SB_50209| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 473 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 519 FSQSRRCKTTAS 484 FSQSRRCKTTAS Sbjct: 37 FSQSRRCKTTAS 48 >SB_50159| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 519 FSQSRRCKTTAS 484 FSQSRRCKTTAS Sbjct: 37 FSQSRRCKTTAS 48 >SB_48895| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 829 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 519 FSQSRRCKTTAS 484 FSQSRRCKTTAS Sbjct: 192 FSQSRRCKTTAS 203 >SB_48885| Best HMM Match : DUF741 (HMM E-Value=0.88) Length = 841 Score = 28.7 bits (61), Expect = 3.1 Identities = 14/42 (33%), Positives = 20/42 (47%) Frame = -1 Query: 515 PSHDVVKRRPVNCNTTHYRANWVPXPPSK*RSDFAPIVDTKY 390 P HD V RR V+ +R+ P +K R+ I + KY Sbjct: 87 PDHDPVVRRSVSFKERRHRSETAPEASNKRRNSDVEIQEVKY 128 >SB_48422| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 519 FSQSRRCKTTAS 484 FSQSRRCKTTAS Sbjct: 59 FSQSRRCKTTAS 70 >SB_47991| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 519 FSQSRRCKTTAS 484 FSQSRRCKTTAS Sbjct: 37 FSQSRRCKTTAS 48 >SB_47859| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 519 FSQSRRCKTTAS 484 FSQSRRCKTTAS Sbjct: 37 FSQSRRCKTTAS 48 >SB_46080| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 68 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 519 FSQSRRCKTTAS 484 FSQSRRCKTTAS Sbjct: 37 FSQSRRCKTTAS 48 >SB_45570| Best HMM Match : Euplotes_phero (HMM E-Value=2.6) Length = 388 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 519 FSQSRRCKTTAS 484 FSQSRRCKTTAS Sbjct: 37 FSQSRRCKTTAS 48 >SB_45449| Best HMM Match : Glyco_hydro_47 (HMM E-Value=1.4e-07) Length = 305 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 519 FSQSRRCKTTAS 484 FSQSRRCKTTAS Sbjct: 37 FSQSRRCKTTAS 48 >SB_43819| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 519 FSQSRRCKTTAS 484 FSQSRRCKTTAS Sbjct: 37 FSQSRRCKTTAS 48 >SB_42593| Best HMM Match : Rho_GDI (HMM E-Value=3.7e-17) Length = 339 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 519 FSQSRRCKTTAS 484 FSQSRRCKTTAS Sbjct: 244 FSQSRRCKTTAS 255 >SB_42373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 68 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 519 FSQSRRCKTTAS 484 FSQSRRCKTTAS Sbjct: 37 FSQSRRCKTTAS 48 >SB_42112| Best HMM Match : Herpes_UL49_2 (HMM E-Value=1.5) Length = 154 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 519 FSQSRRCKTTAS 484 FSQSRRCKTTAS Sbjct: 37 FSQSRRCKTTAS 48 >SB_41202| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 519 FSQSRRCKTTAS 484 FSQSRRCKTTAS Sbjct: 37 FSQSRRCKTTAS 48 >SB_41136| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 115 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 519 FSQSRRCKTTAS 484 FSQSRRCKTTAS Sbjct: 37 FSQSRRCKTTAS 48 >SB_41068| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 519 FSQSRRCKTTAS 484 FSQSRRCKTTAS Sbjct: 59 FSQSRRCKTTAS 70 >SB_40980| Best HMM Match : ANF_receptor (HMM E-Value=0.00014) Length = 735 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 519 FSQSRRCKTTAS 484 FSQSRRCKTTAS Sbjct: 595 FSQSRRCKTTAS 606 >SB_40764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 519 FSQSRRCKTTAS 484 FSQSRRCKTTAS Sbjct: 37 FSQSRRCKTTAS 48 >SB_40601| Best HMM Match : VWA_CoxE (HMM E-Value=6.3) Length = 666 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 519 FSQSRRCKTTAS 484 FSQSRRCKTTAS Sbjct: 442 FSQSRRCKTTAS 453 >SB_40576| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 519 FSQSRRCKTTAS 484 FSQSRRCKTTAS Sbjct: 37 FSQSRRCKTTAS 48 >SB_40463| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 519 FSQSRRCKTTAS 484 FSQSRRCKTTAS Sbjct: 37 FSQSRRCKTTAS 48 >SB_40182| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 519 FSQSRRCKTTAS 484 FSQSRRCKTTAS Sbjct: 37 FSQSRRCKTTAS 48 >SB_40003| Best HMM Match : YTV (HMM E-Value=8.9) Length = 128 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 519 FSQSRRCKTTAS 484 FSQSRRCKTTAS Sbjct: 37 FSQSRRCKTTAS 48 >SB_39444| Best HMM Match : SAC3_GANP (HMM E-Value=0.68) Length = 794 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 519 FSQSRRCKTTAS 484 FSQSRRCKTTAS Sbjct: 37 FSQSRRCKTTAS 48 >SB_38813| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 66 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 519 FSQSRRCKTTAS 484 FSQSRRCKTTAS Sbjct: 37 FSQSRRCKTTAS 48 >SB_38774| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 519 FSQSRRCKTTAS 484 FSQSRRCKTTAS Sbjct: 59 FSQSRRCKTTAS 70 >SB_38425| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 519 FSQSRRCKTTAS 484 FSQSRRCKTTAS Sbjct: 59 FSQSRRCKTTAS 70 >SB_38203| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 519 FSQSRRCKTTAS 484 FSQSRRCKTTAS Sbjct: 37 FSQSRRCKTTAS 48 >SB_37771| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 519 FSQSRRCKTTAS 484 FSQSRRCKTTAS Sbjct: 69 FSQSRRCKTTAS 80 >SB_36681| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1081 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 519 FSQSRRCKTTAS 484 FSQSRRCKTTAS Sbjct: 825 FSQSRRCKTTAS 836 >SB_36014| Best HMM Match : DUF437 (HMM E-Value=6.4) Length = 240 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 519 FSQSRRCKTTAS 484 FSQSRRCKTTAS Sbjct: 59 FSQSRRCKTTAS 70 >SB_35849| Best HMM Match : Fibrinogen_C (HMM E-Value=0.15) Length = 631 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 519 FSQSRRCKTTAS 484 FSQSRRCKTTAS Sbjct: 486 FSQSRRCKTTAS 497 >SB_35317| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 519 FSQSRRCKTTAS 484 FSQSRRCKTTAS Sbjct: 37 FSQSRRCKTTAS 48 >SB_35151| Best HMM Match : DUF589 (HMM E-Value=7.5) Length = 297 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 519 FSQSRRCKTTAS 484 FSQSRRCKTTAS Sbjct: 59 FSQSRRCKTTAS 70 >SB_34685| Best HMM Match : RNA_pol_A_bac (HMM E-Value=1.8) Length = 143 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 519 FSQSRRCKTTAS 484 FSQSRRCKTTAS Sbjct: 59 FSQSRRCKTTAS 70 >SB_34478| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 519 FSQSRRCKTTAS 484 FSQSRRCKTTAS Sbjct: 105 FSQSRRCKTTAS 116 >SB_31889| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 519 FSQSRRCKTTAS 484 FSQSRRCKTTAS Sbjct: 59 FSQSRRCKTTAS 70 >SB_30142| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 519 FSQSRRCKTTAS 484 FSQSRRCKTTAS Sbjct: 51 FSQSRRCKTTAS 62 >SB_29043| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 68 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 519 FSQSRRCKTTAS 484 FSQSRRCKTTAS Sbjct: 37 FSQSRRCKTTAS 48 >SB_28650| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 519 FSQSRRCKTTAS 484 FSQSRRCKTTAS Sbjct: 37 FSQSRRCKTTAS 48 >SB_28487| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 519 FSQSRRCKTTAS 484 FSQSRRCKTTAS Sbjct: 37 FSQSRRCKTTAS 48 >SB_28424| Best HMM Match : SAM_1 (HMM E-Value=8e-06) Length = 214 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 519 FSQSRRCKTTAS 484 FSQSRRCKTTAS Sbjct: 37 FSQSRRCKTTAS 48 >SB_28245| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 519 FSQSRRCKTTAS 484 FSQSRRCKTTAS Sbjct: 37 FSQSRRCKTTAS 48 >SB_27137| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 519 FSQSRRCKTTAS 484 FSQSRRCKTTAS Sbjct: 37 FSQSRRCKTTAS 48 >SB_27095| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 534 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 519 FSQSRRCKTTAS 484 FSQSRRCKTTAS Sbjct: 407 FSQSRRCKTTAS 418 >SB_26954| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 519 FSQSRRCKTTAS 484 FSQSRRCKTTAS Sbjct: 37 FSQSRRCKTTAS 48 >SB_26672| Best HMM Match : Exo_endo_phos (HMM E-Value=0.46) Length = 1232 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 519 FSQSRRCKTTAS 484 FSQSRRCKTTAS Sbjct: 1141 FSQSRRCKTTAS 1152 >SB_26607| Best HMM Match : K_tetra (HMM E-Value=3.3e-08) Length = 412 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 519 FSQSRRCKTTAS 484 FSQSRRCKTTAS Sbjct: 332 FSQSRRCKTTAS 343 >SB_25727| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1758 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 519 FSQSRRCKTTAS 484 FSQSRRCKTTAS Sbjct: 146 FSQSRRCKTTAS 157 >SB_25469| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 87 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 519 FSQSRRCKTTAS 484 FSQSRRCKTTAS Sbjct: 56 FSQSRRCKTTAS 67 >SB_25193| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 519 FSQSRRCKTTAS 484 FSQSRRCKTTAS Sbjct: 37 FSQSRRCKTTAS 48 >SB_24322| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 519 FSQSRRCKTTAS 484 FSQSRRCKTTAS Sbjct: 18 FSQSRRCKTTAS 29 >SB_23294| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 519 FSQSRRCKTTAS 484 FSQSRRCKTTAS Sbjct: 37 FSQSRRCKTTAS 48 >SB_23196| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 519 FSQSRRCKTTAS 484 FSQSRRCKTTAS Sbjct: 30 FSQSRRCKTTAS 41 >SB_23195| Best HMM Match : zf-C3HC4 (HMM E-Value=1.3e-10) Length = 466 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 519 FSQSRRCKTTAS 484 FSQSRRCKTTAS Sbjct: 37 FSQSRRCKTTAS 48 >SB_22108| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 519 FSQSRRCKTTAS 484 FSQSRRCKTTAS Sbjct: 37 FSQSRRCKTTAS 48 >SB_21853| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 79 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 519 FSQSRRCKTTAS 484 FSQSRRCKTTAS Sbjct: 37 FSQSRRCKTTAS 48 >SB_21523| Best HMM Match : Pkinase (HMM E-Value=9.5e-14) Length = 322 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 519 FSQSRRCKTTAS 484 FSQSRRCKTTAS Sbjct: 59 FSQSRRCKTTAS 70 >SB_20847| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 519 FSQSRRCKTTAS 484 FSQSRRCKTTAS Sbjct: 59 FSQSRRCKTTAS 70 >SB_20629| Best HMM Match : WD40 (HMM E-Value=0.0014) Length = 230 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 519 FSQSRRCKTTAS 484 FSQSRRCKTTAS Sbjct: 72 FSQSRRCKTTAS 83 >SB_18983| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 78 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 519 FSQSRRCKTTAS 484 FSQSRRCKTTAS Sbjct: 37 FSQSRRCKTTAS 48 >SB_18796| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 519 FSQSRRCKTTAS 484 FSQSRRCKTTAS Sbjct: 37 FSQSRRCKTTAS 48 >SB_18538| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 189 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 519 FSQSRRCKTTAS 484 FSQSRRCKTTAS Sbjct: 59 FSQSRRCKTTAS 70 >SB_18411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 519 FSQSRRCKTTAS 484 FSQSRRCKTTAS Sbjct: 59 FSQSRRCKTTAS 70 >SB_18318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 519 FSQSRRCKTTAS 484 FSQSRRCKTTAS Sbjct: 37 FSQSRRCKTTAS 48 >SB_18158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 519 FSQSRRCKTTAS 484 FSQSRRCKTTAS Sbjct: 59 FSQSRRCKTTAS 70 >SB_17237| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 78 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 519 FSQSRRCKTTAS 484 FSQSRRCKTTAS Sbjct: 51 FSQSRRCKTTAS 62 >SB_15818| Best HMM Match : Apo-VLDL-II (HMM E-Value=1.2) Length = 218 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 519 FSQSRRCKTTAS 484 FSQSRRCKTTAS Sbjct: 59 FSQSRRCKTTAS 70 >SB_15375| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 519 FSQSRRCKTTAS 484 FSQSRRCKTTAS Sbjct: 37 FSQSRRCKTTAS 48 >SB_14672| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 66 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 519 FSQSRRCKTTAS 484 FSQSRRCKTTAS Sbjct: 37 FSQSRRCKTTAS 48 >SB_14518| Best HMM Match : MIB_HERC2 (HMM E-Value=2.4e-38) Length = 742 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 519 FSQSRRCKTTAS 484 FSQSRRCKTTAS Sbjct: 522 FSQSRRCKTTAS 533 >SB_14044| Best HMM Match : EGF_CA (HMM E-Value=4.1e-13) Length = 184 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 519 FSQSRRCKTTAS 484 FSQSRRCKTTAS Sbjct: 37 FSQSRRCKTTAS 48 >SB_13919| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 519 FSQSRRCKTTAS 484 FSQSRRCKTTAS Sbjct: 37 FSQSRRCKTTAS 48 >SB_13475| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 519 FSQSRRCKTTAS 484 FSQSRRCKTTAS Sbjct: 37 FSQSRRCKTTAS 48 >SB_13295| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 66 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 519 FSQSRRCKTTAS 484 FSQSRRCKTTAS Sbjct: 37 FSQSRRCKTTAS 48 >SB_13049| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 519 FSQSRRCKTTAS 484 FSQSRRCKTTAS Sbjct: 37 FSQSRRCKTTAS 48 >SB_12559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 519 FSQSRRCKTTAS 484 FSQSRRCKTTAS Sbjct: 37 FSQSRRCKTTAS 48 >SB_12016| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 519 FSQSRRCKTTAS 484 FSQSRRCKTTAS Sbjct: 37 FSQSRRCKTTAS 48 >SB_11991| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 519 FSQSRRCKTTAS 484 FSQSRRCKTTAS Sbjct: 130 FSQSRRCKTTAS 141 >SB_11294| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 519 FSQSRRCKTTAS 484 FSQSRRCKTTAS Sbjct: 90 FSQSRRCKTTAS 101 >SB_10976| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 519 FSQSRRCKTTAS 484 FSQSRRCKTTAS Sbjct: 37 FSQSRRCKTTAS 48 >SB_10247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 519 FSQSRRCKTTAS 484 FSQSRRCKTTAS Sbjct: 37 FSQSRRCKTTAS 48 >SB_9391| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 519 FSQSRRCKTTAS 484 FSQSRRCKTTAS Sbjct: 37 FSQSRRCKTTAS 48 >SB_9055| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 519 FSQSRRCKTTAS 484 FSQSRRCKTTAS Sbjct: 37 FSQSRRCKTTAS 48 >SB_8565| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 519 FSQSRRCKTTAS 484 FSQSRRCKTTAS Sbjct: 37 FSQSRRCKTTAS 48 >SB_8222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 519 FSQSRRCKTTAS 484 FSQSRRCKTTAS Sbjct: 92 FSQSRRCKTTAS 103 >SB_8126| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 519 FSQSRRCKTTAS 484 FSQSRRCKTTAS Sbjct: 37 FSQSRRCKTTAS 48 >SB_7261| Best HMM Match : RHS (HMM E-Value=5.3) Length = 137 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 519 FSQSRRCKTTAS 484 FSQSRRCKTTAS Sbjct: 59 FSQSRRCKTTAS 70 >SB_7005| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 519 FSQSRRCKTTAS 484 FSQSRRCKTTAS Sbjct: 37 FSQSRRCKTTAS 48 >SB_6339| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 519 FSQSRRCKTTAS 484 FSQSRRCKTTAS Sbjct: 86 FSQSRRCKTTAS 97 >SB_6047| Best HMM Match : CXC (HMM E-Value=7.7) Length = 90 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 519 FSQSRRCKTTAS 484 FSQSRRCKTTAS Sbjct: 37 FSQSRRCKTTAS 48 >SB_5753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 519 FSQSRRCKTTAS 484 FSQSRRCKTTAS Sbjct: 37 FSQSRRCKTTAS 48 >SB_5503| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 519 FSQSRRCKTTAS 484 FSQSRRCKTTAS Sbjct: 37 FSQSRRCKTTAS 48 >SB_5427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 374 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 519 FSQSRRCKTTAS 484 FSQSRRCKTTAS Sbjct: 37 FSQSRRCKTTAS 48 >SB_4286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 519 FSQSRRCKTTAS 484 FSQSRRCKTTAS Sbjct: 37 FSQSRRCKTTAS 48 >SB_4268| Best HMM Match : MtrG (HMM E-Value=1.2) Length = 542 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 519 FSQSRRCKTTAS 484 FSQSRRCKTTAS Sbjct: 191 FSQSRRCKTTAS 202 >SB_4192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 519 FSQSRRCKTTAS 484 FSQSRRCKTTAS Sbjct: 37 FSQSRRCKTTAS 48 >SB_3720| Best HMM Match : RVT_1 (HMM E-Value=0.0031) Length = 546 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 519 FSQSRRCKTTAS 484 FSQSRRCKTTAS Sbjct: 37 FSQSRRCKTTAS 48 >SB_3671| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 519 FSQSRRCKTTAS 484 FSQSRRCKTTAS Sbjct: 59 FSQSRRCKTTAS 70 >SB_2384| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 519 FSQSRRCKTTAS 484 FSQSRRCKTTAS Sbjct: 59 FSQSRRCKTTAS 70 >SB_1609| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 519 FSQSRRCKTTAS 484 FSQSRRCKTTAS Sbjct: 37 FSQSRRCKTTAS 48 >SB_751| Best HMM Match : rve (HMM E-Value=7.5e-12) Length = 338 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 519 FSQSRRCKTTAS 484 FSQSRRCKTTAS Sbjct: 59 FSQSRRCKTTAS 70 >SB_266| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 519 FSQSRRCKTTAS 484 FSQSRRCKTTAS Sbjct: 37 FSQSRRCKTTAS 48 >SB_59| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 519 FSQSRRCKTTAS 484 FSQSRRCKTTAS Sbjct: 37 FSQSRRCKTTAS 48 >SB_58440| Best HMM Match : Ribosomal_L9_C (HMM E-Value=0.81) Length = 427 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 519 FSQSRRCKTTAS 484 FSQSRRCKTTAS Sbjct: 59 FSQSRRCKTTAS 70 >SB_58394| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 519 FSQSRRCKTTAS 484 FSQSRRCKTTAS Sbjct: 37 FSQSRRCKTTAS 48 >SB_57506| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 519 FSQSRRCKTTAS 484 FSQSRRCKTTAS Sbjct: 37 FSQSRRCKTTAS 48 >SB_57021| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 519 FSQSRRCKTTAS 484 FSQSRRCKTTAS Sbjct: 37 FSQSRRCKTTAS 48 >SB_56970| Best HMM Match : Thaumatin (HMM E-Value=5.4) Length = 200 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 519 FSQSRRCKTTAS 484 FSQSRRCKTTAS Sbjct: 59 FSQSRRCKTTAS 70 >SB_56955| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 87 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 519 FSQSRRCKTTAS 484 FSQSRRCKTTAS Sbjct: 51 FSQSRRCKTTAS 62 >SB_56767| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 519 FSQSRRCKTTAS 484 FSQSRRCKTTAS Sbjct: 37 FSQSRRCKTTAS 48 >SB_56729| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 519 FSQSRRCKTTAS 484 FSQSRRCKTTAS Sbjct: 37 FSQSRRCKTTAS 48 >SB_56672| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 519 FSQSRRCKTTAS 484 FSQSRRCKTTAS Sbjct: 37 FSQSRRCKTTAS 48 >SB_56555| Best HMM Match : 7tm_1 (HMM E-Value=4.4) Length = 220 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 519 FSQSRRCKTTAS 484 FSQSRRCKTTAS Sbjct: 37 FSQSRRCKTTAS 48 >SB_56099| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 519 FSQSRRCKTTAS 484 FSQSRRCKTTAS Sbjct: 37 FSQSRRCKTTAS 48 >SB_55954| Best HMM Match : TIL (HMM E-Value=0.74) Length = 172 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 519 FSQSRRCKTTAS 484 FSQSRRCKTTAS Sbjct: 59 FSQSRRCKTTAS 70 >SB_55138| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 519 FSQSRRCKTTAS 484 FSQSRRCKTTAS Sbjct: 37 FSQSRRCKTTAS 48 >SB_55112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 519 FSQSRRCKTTAS 484 FSQSRRCKTTAS Sbjct: 37 FSQSRRCKTTAS 48 >SB_54421| Best HMM Match : HipA_C (HMM E-Value=7.5) Length = 248 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 519 FSQSRRCKTTAS 484 FSQSRRCKTTAS Sbjct: 59 FSQSRRCKTTAS 70 >SB_54343| Best HMM Match : TipAS (HMM E-Value=0.77) Length = 316 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 519 FSQSRRCKTTAS 484 FSQSRRCKTTAS Sbjct: 37 FSQSRRCKTTAS 48 >SB_54153| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 79 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 519 FSQSRRCKTTAS 484 FSQSRRCKTTAS Sbjct: 37 FSQSRRCKTTAS 48 >SB_54005| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 519 FSQSRRCKTTAS 484 FSQSRRCKTTAS Sbjct: 37 FSQSRRCKTTAS 48 >SB_53974| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 519 FSQSRRCKTTAS 484 FSQSRRCKTTAS Sbjct: 37 FSQSRRCKTTAS 48 >SB_53662| Best HMM Match : Protamine_P2 (HMM E-Value=9.2) Length = 253 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 519 FSQSRRCKTTAS 484 FSQSRRCKTTAS Sbjct: 228 FSQSRRCKTTAS 239 >SB_53598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 196 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 519 FSQSRRCKTTAS 484 FSQSRRCKTTAS Sbjct: 164 FSQSRRCKTTAS 175 >SB_53044| Best HMM Match : TcpA (HMM E-Value=3.1) Length = 195 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 519 FSQSRRCKTTAS 484 FSQSRRCKTTAS Sbjct: 59 FSQSRRCKTTAS 70 >SB_52956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 519 FSQSRRCKTTAS 484 FSQSRRCKTTAS Sbjct: 37 FSQSRRCKTTAS 48 >SB_51739| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 519 FSQSRRCKTTAS 484 FSQSRRCKTTAS Sbjct: 37 FSQSRRCKTTAS 48 >SB_51732| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 519 FSQSRRCKTTAS 484 FSQSRRCKTTAS Sbjct: 37 FSQSRRCKTTAS 48 >SB_51109| Best HMM Match : ATP-cone (HMM E-Value=0.76) Length = 250 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 519 FSQSRRCKTTAS 484 FSQSRRCKTTAS Sbjct: 37 FSQSRRCKTTAS 48 >SB_50972| Best HMM Match : MH1 (HMM E-Value=7.1) Length = 283 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 519 FSQSRRCKTTAS 484 FSQSRRCKTTAS Sbjct: 135 FSQSRRCKTTAS 146 >SB_50818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 109 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 519 FSQSRRCKTTAS 484 FSQSRRCKTTAS Sbjct: 59 FSQSRRCKTTAS 70 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,248,534 Number of Sequences: 59808 Number of extensions: 292658 Number of successful extensions: 3483 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 3425 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3479 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1172759136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -