BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS312H05f (521 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_01_0605 + 4497308-4497472,4497719-4497904,4498898-4499003,449... 55 4e-08 05_01_0562 + 4907937-4907990,4908890-4909075,4909180-4909285,490... 50 1e-06 02_05_0261 + 27243898-27243938,27244068-27244157,27244293-272443... 49 3e-06 02_02_0321 - 8934512-8935504,8935581-8935715,8935831-8936217 48 6e-06 08_01_0008 - 65366-65497,65588-65759,65846-65972,66058-66140,662... 46 1e-05 01_06_0175 + 27229878-27230056,27231102-27231159,27231230-272312... 44 7e-05 06_03_1487 + 30477615-30477658,30477778-30477891,30477941-304780... 40 0.002 02_03_0176 + 16010806-16011095,16011983-16012061,16012389-160124... 37 0.009 01_03_0302 + 14790674-14791354 33 0.14 08_01_0527 + 4580599-4580818,4580933-4581806,4581891-4581955,458... 31 0.42 04_04_0814 + 28266590-28266615,28266780-28266860,28266986-282670... 30 0.98 01_02_0130 - 11424904-11425142,11425295-11425416,11425461-114255... 30 0.98 10_08_0964 + 21906737-21907993 30 1.3 03_01_0360 + 2815067-2816033,2816120-2816198,2816275-2816342,281... 29 2.3 09_04_0260 - 16197522-16197669,16198027-16198130,16198508-161987... 29 3.0 07_01_0146 - 1068314-1068656,1069349-1069507,1069642-1069835 29 3.0 02_03_0238 + 16730444-16730448,16730484-16730586,16732043-167320... 29 3.0 10_08_0383 - 17424194-17425567 28 4.0 04_04_1445 - 33658355-33658417,33658536-33658669,33659056-336591... 28 4.0 12_01_1023 + 10458092-10458397,10459126-10459254,10459335-104595... 28 5.2 09_04_0168 - 15295442-15295477,15295478-15295552,15295660-152957... 28 5.2 11_01_0699 - 5757410-5757458,5757760-5757831,5758084-5758152,575... 27 9.1 10_01_0171 + 1917520-1918056,1919201-1919336,1921873-1922060,192... 27 9.1 05_01_0421 + 3308692-3309070,3309199-3309339,3309776-3309897,331... 27 9.1 03_02_0459 + 8649448-8651994 27 9.1 >01_01_0605 + 4497308-4497472,4497719-4497904,4498898-4499003, 4499062-4499216,4499341-4499424,4499498-4499589, 4499729-4499837,4499944-4500030,4500153-4500245, 4501144-4501341,4501481-4501632,4501724-4501874, 4501975-4502073,4502159-4502326,4502624-4502702, 4502870-4503000 Length = 684 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/68 (33%), Positives = 40/68 (58%) Frame = +1 Query: 253 KRPMNAFMVFAQAMRRRLSAERPSLHNAELSKSLGSMWKNLSEEEKLPFIKEADKLRTQH 432 KR M FM F+ A R + P L E++K LG MW+ ++ EEK P+I+++ + ++ Sbjct: 600 KRAMTPFMYFSMAERGNMKNNNPDLPTTEIAKKLGEMWQKMTGEEKQPYIQQSQVDKKRY 659 Query: 433 KKQHPDYK 456 +K+ Y+ Sbjct: 660 EKESAVYR 667 >05_01_0562 + 4907937-4907990,4908890-4909075,4909180-4909285, 4909377-4909513,4909989-4910072,4910157-4910248, 4910358-4910466,4910554-4910640,4910737-4910829, 4911384-4911581,4911659-4911810,4911910-4912060, 4912174-4912272,4912362-4912535,4912680-4912758, 4912858-4912979 Length = 640 Score = 49.6 bits (113), Expect = 1e-06 Identities = 20/68 (29%), Positives = 39/68 (57%) Frame = +1 Query: 253 KRPMNAFMVFAQAMRRRLSAERPSLHNAELSKSLGSMWKNLSEEEKLPFIKEADKLRTQH 432 KR + FM F++A R L P L E++K LG W+ ++ EEK P+++++ + ++ Sbjct: 559 KRAIAPFMYFSKAERANLKNSNPELATTEIAKKLGERWQKMTAEEKQPYVEQSQVDKKRY 618 Query: 433 KKQHPDYK 456 ++ Y+ Sbjct: 619 AEESAAYR 626 >02_05_0261 + 27243898-27243938,27244068-27244157,27244293-27244350, 27244441-27244485,27244778-27244855,27244940-27245041, 27245150-27245173 Length = 145 Score = 48.8 bits (111), Expect = 3e-06 Identities = 22/68 (32%), Positives = 39/68 (57%), Gaps = 1/68 (1%) Frame = +1 Query: 253 KRPMNAFMVFAQAMRRRLSAERPSLHN-AELSKSLGSMWKNLSEEEKLPFIKEADKLRTQ 429 KRP +AF VF R+ A P + A +SK+ G W+ +SE+EK P++ +A + + Sbjct: 34 KRPPSAFFVFMSEFRQEYQAAHPDNKSVAAVSKAAGEKWRAMSEQEKAPYVDKAGQKKQD 93 Query: 430 HKKQHPDY 453 ++K ++ Sbjct: 94 YEKTKANF 101 >02_02_0321 - 8934512-8935504,8935581-8935715,8935831-8936217 Length = 504 Score = 47.6 bits (108), Expect = 6e-06 Identities = 24/68 (35%), Positives = 39/68 (57%) Frame = +1 Query: 253 KRPMNAFMVFAQAMRRRLSAERPSLHNAELSKSLGSMWKNLSEEEKLPFIKEADKLRTQH 432 K+PM+A+ V+ Q R L AE+ ++ E+ + G WK +SE EK PF A K R ++ Sbjct: 286 KQPMSAYFVYTQQRRAALVAEKKNV--PEIGRITGEEWKAMSEAEKAPFEAAARKQREEY 343 Query: 433 KKQHPDYK 456 + + Y+ Sbjct: 344 QVEMAAYR 351 Score = 46.4 bits (105), Expect = 1e-05 Identities = 20/67 (29%), Positives = 40/67 (59%) Frame = +1 Query: 253 KRPMNAFMVFAQAMRRRLSAERPSLHNAELSKSLGSMWKNLSEEEKLPFIKEADKLRTQH 432 K+P ++F++F++ RR+L+ ERP + ++ L+ + WK L E EK + +A + + Sbjct: 415 KKPASSFLLFSKEARRQLAEERPGVASSTLTALVSVKWKELGEAEKQAWNGKAAEAMAAY 474 Query: 433 KKQHPDY 453 K+ +Y Sbjct: 475 KRDMEEY 481 Score = 37.9 bits (84), Expect = 0.005 Identities = 16/49 (32%), Positives = 27/49 (55%) Frame = +1 Query: 253 KRPMNAFMVFAQAMRRRLSAERPSLHNAELSKSLGSMWKNLSEEEKLPF 399 K+P A++++ + + E P E+S +LG+ WK L EEK P+ Sbjct: 158 KKPCPAYVLWCKDQWNEIKKESPDADFKEVSNALGAKWKALGAEEKQPY 206 >08_01_0008 - 65366-65497,65588-65759,65846-65972,66058-66140, 66232-66329 Length = 203 Score = 46.4 bits (105), Expect = 1e-05 Identities = 20/61 (32%), Positives = 36/61 (59%), Gaps = 1/61 (1%) Frame = +1 Query: 253 KRPMNAFMVFAQAMRRRLSAERPSLHNAE-LSKSLGSMWKNLSEEEKLPFIKEADKLRTQ 429 KRP AF +F R+ AE P + ++K G WK++S+E+K P++ +A +L+ + Sbjct: 93 KRPPTAFFLFMSDFRKEYKAEHPDNKSVSAVAKEGGERWKSMSDEDKKPYLDKAAELKAE 152 Query: 430 H 432 + Sbjct: 153 Y 153 >01_06_0175 + 27229878-27230056,27231102-27231159,27231230-27231274, 27232711-27232791,27232884-27232922 Length = 133 Score = 44.0 bits (99), Expect = 7e-05 Identities = 22/78 (28%), Positives = 39/78 (50%), Gaps = 1/78 (1%) Frame = +1 Query: 208 PQPTKGGGCMRRPHVKRPMNAFMVFAQAMRRRLSAERPSLHN-AELSKSLGSMWKNLSEE 384 P KG + R K+P AF F + R+ E PS+ + E+ K+ G W ++ E Sbjct: 35 PSRKKGQPLVDRRRPKKPPTAFFYFMEDFRKTYKEENPSVKSMQEVGKACGEKWNTMTFE 94 Query: 385 EKLPFIKEADKLRTQHKK 438 E++ + A + R +++K Sbjct: 95 ERVKYYDIATEKRAEYEK 112 >06_03_1487 + 30477615-30477658,30477778-30477891,30477941-30478028, 30478186-30478230,30478330-30478410,30478498-30478608, 30478907-30478927 Length = 167 Score = 39.5 bits (88), Expect = 0.002 Identities = 19/68 (27%), Positives = 37/68 (54%), Gaps = 2/68 (2%) Frame = +1 Query: 286 QAMRRRLSAERPSLHN-AELSKSLGSMWKNLSEEEKLPFIKEADKLRTQHKKQHPDY-KY 459 + R+ + P + A + K+ G WK+L+E +K P++ +A+KL+ ++ K Y K Sbjct: 64 EEFRKEFKEKNPKNKSVAAVGKAAGDRWKSLTEADKAPYVAKANKLKAEYNKAIAAYNKG 123 Query: 460 QPRRRKPP 483 + +K P Sbjct: 124 ESTAKKAP 131 >02_03_0176 + 16010806-16011095,16011983-16012061,16012389-16012464, 16012541-16012630,16012878-16013031,16013172-16013181, 16013240-16013407,16014087-16014485,16014580-16014990 Length = 558 Score = 37.1 bits (82), Expect = 0.009 Identities = 22/83 (26%), Positives = 42/83 (50%) Frame = +1 Query: 247 HVKRPMNAFMVFAQAMRRRLSAERPSLHNAELSKSLGSMWKNLSEEEKLPFIKEADKLRT 426 H K + + F Q R+L E P + +SK +G W NL E+K + ++ + + Sbjct: 375 HPKPNRSGYNFFFQDQHRKLKPEYPG-QDRLISKMIGERWNNLGPEDKAVYQEKGVEDKA 433 Query: 427 QHKKQHPDYKYQPRRRKPPLASA 495 ++++Q Y+ Q R P+++A Sbjct: 434 RYQRQLALYREQ--RTGQPISNA 454 >01_03_0302 + 14790674-14791354 Length = 226 Score = 33.1 bits (72), Expect = 0.14 Identities = 18/39 (46%), Positives = 22/39 (56%), Gaps = 2/39 (5%) Frame = +1 Query: 199 TILPQPTKGGGCMRRP--HVKRPMNAFMVFAQAMRRRLS 309 T LPQP KG GC R P V+ PM +++ A RR S Sbjct: 73 TSLPQPKKGRGCPRHPLEEVEEPMTG-LIYCVATRRARS 110 >08_01_0527 + 4580599-4580818,4580933-4581806,4581891-4581955, 4582055-4582110,4582955-4583058,4583310-4583382, 4583474-4583654,4584537-4584622 Length = 552 Score = 31.5 bits (68), Expect = 0.42 Identities = 15/53 (28%), Positives = 25/53 (47%) Frame = +1 Query: 316 RPSLHNAELSKSLGSMWKNLSEEEKLPFIKEADKLRTQHKKQHPDYKYQPRRR 474 R H++E K L W+ + + + P + RT+H + P+ PRRR Sbjct: 248 RKGRHDSEEPKDLLPPWRRVRHDSEEPKDLSPPRRRTRHDSEEPEDLSPPRRR 300 >04_04_0814 + 28266590-28266615,28266780-28266860,28266986-28267043, 28267143-28267187,28268653-28268721,28268821-28268931, 28269038-28269046 Length = 132 Score = 30.3 bits (65), Expect = 0.98 Identities = 14/50 (28%), Positives = 25/50 (50%), Gaps = 1/50 (2%) Frame = +1 Query: 253 KRPMNAFMVFAQAMRRRLSAERPSLHN-AELSKSLGSMWKNLSEEEKLPF 399 KR + F F R + + P+ A ++K+ G W+ +S+EEK + Sbjct: 26 KRGLTPFFAFLAEFRPQYMEKHPNTKGVAAVTKAAGEKWRAMSDEEKAQY 75 >01_02_0130 - 11424904-11425142,11425295-11425416,11425461-11425546, 11425642-11425858,11426788-11426832,11428385-11428593, 11428706-11428936 Length = 382 Score = 30.3 bits (65), Expect = 0.98 Identities = 15/38 (39%), Positives = 21/38 (55%), Gaps = 3/38 (7%) Frame = +1 Query: 355 GSMW-KNLSEEEKLP--FIKEADKLRTQHKKQHPDYKY 459 GSMW N E++L +K AD Q + HPDY++ Sbjct: 341 GSMWTSNQEHEQQLTKSLLKAADDWLCQRRVNHPDYRF 378 >10_08_0964 + 21906737-21907993 Length = 418 Score = 29.9 bits (64), Expect = 1.3 Identities = 10/20 (50%), Positives = 15/20 (75%) Frame = -3 Query: 249 VWTTHTPTTFRWLRQYCIVV 190 +WTT++P+ W R+YCI V Sbjct: 325 IWTTNSPSFDDWERRYCIYV 344 >03_01_0360 + 2815067-2816033,2816120-2816198,2816275-2816342, 2817382-2817464,2821566-2823083 Length = 904 Score = 29.1 bits (62), Expect = 2.3 Identities = 12/39 (30%), Positives = 22/39 (56%), Gaps = 3/39 (7%) Frame = -3 Query: 318 SFGRQTAAHRLREHHECIHRSLDVWT---THTPTTFRWL 211 S G++ ++H+ + H+C+HR + P TF+WL Sbjct: 823 SCGKRFSSHKYLKRHQCVHRDERPFKCPWDGCPMTFKWL 861 >09_04_0260 - 16197522-16197669,16198027-16198130,16198508-16198719, 16198795-16198900,16199006-16199119,16199200-16199417, 16199837-16199900,16199982-16200335,16200609-16200767, 16201486-16202907 Length = 966 Score = 28.7 bits (61), Expect = 3.0 Identities = 11/41 (26%), Positives = 19/41 (46%) Frame = +2 Query: 305 CRPNDPPCTTPNSANH*DPCGKI*AKRRSCLSLKKQISYER 427 C D P PNS N +PCG+ ++R + + + + Sbjct: 466 CLDGDKPAKEPNSDNQNEPCGESNVEKRRVMEWLRNLGLSK 506 >07_01_0146 - 1068314-1068656,1069349-1069507,1069642-1069835 Length = 231 Score = 28.7 bits (61), Expect = 3.0 Identities = 14/42 (33%), Positives = 24/42 (57%) Frame = +1 Query: 379 EEEKLPFIKEADKLRTQHKKQHPDYKYQPRRRKPPLASASTP 504 EEE++ ++EA + T+ K P Y P + +AS+S+P Sbjct: 142 EEEEVVVVEEAAEEDTEGKNYSPGYTPSPDHPETGVASSSSP 183 >02_03_0238 + 16730444-16730448,16730484-16730586,16732043-16732099, 16732198-16732346,16732450-16732545,16732620-16732695, 16732810-16732883,16732991-16733408 Length = 325 Score = 28.7 bits (61), Expect = 3.0 Identities = 16/45 (35%), Positives = 22/45 (48%) Frame = +1 Query: 301 RLSAERPSLHNAELSKSLGSMWKNLSEEEKLPFIKEADKLRTQHK 435 R + P L + K +WK +SEEE L KE DK + H+ Sbjct: 16 RKEFDHPKLQADTIGKRF--LWKCISEEELLQATKELDKELSMHE 58 >10_08_0383 - 17424194-17425567 Length = 457 Score = 28.3 bits (60), Expect = 4.0 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = +1 Query: 430 HKKQHPDYKYQPRRRKPPLASASTP 504 H HP ++ PRRR P +S+S+P Sbjct: 89 HAPPHPPPRHLPRRRSPFTSSSSSP 113 >04_04_1445 - 33658355-33658417,33658536-33658669,33659056-33659116, 33659197-33659356,33660032-33660081,33662237-33662290, 33662630-33662704,33662821-33662949,33663065-33663152, 33663266-33663372,33663513-33663561,33663657-33663760, 33663941-33663980,33664409-33664659,33664674-33664686, 33665846-33666355,33666437-33667657,33667973-33668221, 33668305-33668531 Length = 1194 Score = 28.3 bits (60), Expect = 4.0 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = +1 Query: 238 RRPHVKRPMNAFMVFAQAMRRRLSAERPSLH 330 R H + P + A+ +RR LS RPSLH Sbjct: 29 RSTHRRTPHGSDSTVARLLRRALSRSRPSLH 59 >12_01_1023 + 10458092-10458397,10459126-10459254,10459335-10459553, 10459649-10459987,10460095-10460199,10460697-10460807, 10461438-10461688,10462023-10462146,10462440-10462716, 10463212-10463357,10463449-10463598,10463678-10463910, 10464246-10464375,10464406-10464510,10464636-10464914 Length = 967 Score = 27.9 bits (59), Expect = 5.2 Identities = 22/69 (31%), Positives = 30/69 (43%), Gaps = 4/69 (5%) Frame = -1 Query: 512 LTLGVEAEASGGFRRRGWYL*SGCCFLCCVRNLSAS----LMKGSFSSSLKFFHMDPNDL 345 L+ G + SG RRG G C L + S ++KGS S FH+ N L Sbjct: 438 LSSGEYIQMSGRAGRRGIDQ-RGICILMVDEKMEPSTAKMILKGSADSLNSAFHLSYNML 496 Query: 344 LSSALCREG 318 L+ C +G Sbjct: 497 LNQIRCEDG 505 >09_04_0168 - 15295442-15295477,15295478-15295552,15295660-15295722, 15296095-15296319,15296421-15296562,15296678-15296839, 15298148-15298320,15300352-15300882 Length = 468 Score = 27.9 bits (59), Expect = 5.2 Identities = 12/24 (50%), Positives = 15/24 (62%), Gaps = 1/24 (4%) Frame = -3 Query: 252 DVWTTHTPTTFRWL-RQYCIVVKY 184 D+WT HTP F L R Y +VK+ Sbjct: 182 DLWTDHTPWPFNQLPRSYSFLVKH 205 >11_01_0699 - 5757410-5757458,5757760-5757831,5758084-5758152, 5758329-5758477,5758568-5758699,5758784-5759109, 5759330-5759399,5759684-5759738,5760322-5760377, 5760500-5760700,5761466-5761651,5761756-5761906, 5761978-5762206,5762321-5762582,5762858-5762959 Length = 702 Score = 27.1 bits (57), Expect = 9.1 Identities = 13/37 (35%), Positives = 20/37 (54%), Gaps = 1/37 (2%) Frame = -3 Query: 231 PTTFRWLRQYCIVVKYFHE-FSDGLVYLQLVPGPVAL 124 PT F+ ++ C +KY HE + +L L PG + L Sbjct: 130 PTRFKIIKGTCEGLKYLHEGLKPPIYHLDLKPGNILL 166 >10_01_0171 + 1917520-1918056,1919201-1919336,1921873-1922060, 1922491-1922694,1923913-1924425 Length = 525 Score = 27.1 bits (57), Expect = 9.1 Identities = 13/48 (27%), Positives = 23/48 (47%) Frame = +1 Query: 334 AELSKSLGSMWKNLSEEEKLPFIKEADKLRTQHKKQHPDYKYQPRRRK 477 A+ + GS W+ +EE + PF+ E + P+ +Q R+K Sbjct: 142 ADRQRWKGSRWRPWAEERQAPFVVELASRSRRRDGLSPEALWQEYRQK 189 >05_01_0421 + 3308692-3309070,3309199-3309339,3309776-3309897, 3310369-3310632,3310719-3310849,3311254-3311461, 3311564-3311632,3311722-3311799,3312448-3312621 Length = 521 Score = 27.1 bits (57), Expect = 9.1 Identities = 11/36 (30%), Positives = 21/36 (58%) Frame = +3 Query: 273 HGVRASDAPPFVGRTTLPAQRRTQQIIRIHVEKFKR 380 HG AS P + T P R++ +I+R+ V++ ++ Sbjct: 97 HGTLASRPLPPIHPPTTPRVRKSSRIVRLEVDRLQK 132 >03_02_0459 + 8649448-8651994 Length = 848 Score = 27.1 bits (57), Expect = 9.1 Identities = 23/73 (31%), Positives = 39/73 (53%), Gaps = 4/73 (5%) Frame = +1 Query: 277 VFAQAMRRRLSAERPSLHNAELSKSLGSMWKNLSEEEKLPFIKEADKLRTQHKKQHPDYK 456 V A M R+ + RP+ A+L+K++ + + SEE K +KEA K+ TQ + + Sbjct: 469 VRAAEMYTRVLSIRPNHWRAQLNKAVALLGQGESEEAK-KALKEAFKM-TQRVEVYDAIS 526 Query: 457 Y----QPRRRKPP 483 + Q ++ KPP Sbjct: 527 HLKTLQKKKPKPP 539 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,638,620 Number of Sequences: 37544 Number of extensions: 361083 Number of successful extensions: 1183 Number of sequences better than 10.0: 25 Number of HSP's better than 10.0 without gapping: 1140 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1181 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1142636160 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -