BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS312H05f (521 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_53304| Best HMM Match : HMG_box (HMM E-Value=1.9e-32) 134 3e-32 SB_42643| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 2e-26 SB_33348| Best HMM Match : HMG_box (HMM E-Value=3.2e-34) 116 2e-26 SB_29734| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 8e-26 SB_15122| Best HMM Match : No HMM Matches (HMM E-Value=.) 111 4e-25 SB_13764| Best HMM Match : No HMM Matches (HMM E-Value=.) 108 2e-24 SB_26162| Best HMM Match : HMG_box (HMM E-Value=1.5e-31) 106 1e-23 SB_3516| Best HMM Match : No HMM Matches (HMM E-Value=.) 106 1e-23 SB_27742| Best HMM Match : HMG_box (HMM E-Value=1.3e-24) 104 4e-23 SB_24989| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 2e-22 SB_40969| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 3e-22 SB_41131| Best HMM Match : HMG_box (HMM E-Value=4.1e-28) 100 6e-22 SB_31139| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 6e-22 SB_25642| Best HMM Match : HMG_box (HMM E-Value=1.3e-29) 99 1e-21 SB_10678| Best HMM Match : HMG_box (HMM E-Value=1.3e-29) 99 1e-21 SB_16422| Best HMM Match : HMG_box (HMM E-Value=8.7e-26) 90 9e-19 SB_52386| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 2e-17 SB_16481| Best HMM Match : HMG_box (HMM E-Value=1.2e-08) 72 3e-13 SB_29576| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 2e-12 SB_12646| Best HMM Match : SSrecog (HMM E-Value=0) 48 5e-06 SB_21901| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 8e-06 SB_23256| Best HMM Match : HMG_box (HMM E-Value=3.3e-22) 47 8e-06 SB_1832| Best HMM Match : HMG_box (HMM E-Value=1.7e-22) 46 1e-05 SB_18968| Best HMM Match : HMG_box (HMM E-Value=1.2e-19) 46 3e-05 SB_16438| Best HMM Match : HMG_box (HMM E-Value=7.2e-31) 44 6e-05 SB_7134| Best HMM Match : HMG_box (HMM E-Value=2e-16) 44 1e-04 SB_23680| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 1e-04 SB_9716| Best HMM Match : HMG_box (HMM E-Value=0.0041) 40 0.001 SB_37758| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_606| Best HMM Match : HMG_box (HMM E-Value=0.19) 36 0.020 SB_46509| Best HMM Match : HMG_box (HMM E-Value=4.2e-10) 36 0.027 SB_12182| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_25919| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.11 SB_8660| Best HMM Match : Carboxyl_trans (HMM E-Value=0) 33 0.19 SB_30587| Best HMM Match : IncA (HMM E-Value=0.42) 31 0.76 SB_13394| Best HMM Match : Chordopox_A13L (HMM E-Value=3.2) 30 1.0 SB_4907| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_26483| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_22143| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.8 SB_53479| Best HMM Match : Zot (HMM E-Value=1.1) 29 2.3 SB_25447| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.3 SB_27114| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.3 SB_12475| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_2026| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_27115| Best HMM Match : SAM_1 (HMM E-Value=1.7e-08) 29 3.1 SB_11329| Best HMM Match : DUF1151 (HMM E-Value=0.0015) 29 3.1 SB_30665| Best HMM Match : F5_F8_type_C (HMM E-Value=2.5e-19) 28 4.1 SB_29861| Best HMM Match : RRM_1 (HMM E-Value=1.10002e-42) 28 4.1 SB_39468| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.4 SB_6267| Best HMM Match : DUF930 (HMM E-Value=3.6) 28 5.4 SB_20773| Best HMM Match : DNA_pol_B_exo (HMM E-Value=2.5e-37) 27 7.1 SB_53736| Best HMM Match : Borrelia_orfA (HMM E-Value=0.64) 27 9.4 SB_33520| Best HMM Match : 7tm_1 (HMM E-Value=7.3e-09) 27 9.4 >SB_53304| Best HMM Match : HMG_box (HMM E-Value=1.9e-32) Length = 398 Score = 134 bits (325), Expect = 3e-32 Identities = 61/109 (55%), Positives = 86/109 (78%), Gaps = 1/109 (0%) Frame = +1 Query: 154 INEAVGKLVKIFDYDTILPQPTKGGGCM-RRPHVKRPMNAFMVFAQAMRRRLSAERPSLH 330 I AV ++ +D+ +++P P + G ++PHVKRPMNAFMV+AQA RR+L+ + P LH Sbjct: 32 IASAVNHVLDGYDW-SLIPLPVRVNGIKTQKPHVKRPMNAFMVWAQAARRKLADQYPHLH 90 Query: 331 NAELSKSLGSMWKNLSEEEKLPFIKEADKLRTQHKKQHPDYKYQPRRRK 477 NAELSK+LG +WK L++ EK PFI+EA++LR +HK++HPDYKYQPRR+K Sbjct: 91 NAELSKTLGKLWKLLNDSEKKPFIEEAERLRIKHKREHPDYKYQPRRKK 139 >SB_42643| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 557 Score = 116 bits (278), Expect = 2e-26 Identities = 47/80 (58%), Positives = 65/80 (81%) Frame = +1 Query: 247 HVKRPMNAFMVFAQAMRRRLSAERPSLHNAELSKSLGSMWKNLSEEEKLPFIKEADKLRT 426 HVKRPMNAFMV+++ RR+++ E P +HN+E+SK LGS WK L++++K PF++EA KLR Sbjct: 326 HVKRPMNAFMVWSREERRKIAQENPKMHNSEISKRLGSEWKQLADDDKKPFVEEAKKLRA 385 Query: 427 QHKKQHPDYKYQPRRRKPPL 486 QH K+HPDYKY+PRR+ L Sbjct: 386 QHMKEHPDYKYRPRRKPKSL 405 >SB_33348| Best HMM Match : HMG_box (HMM E-Value=3.2e-34) Length = 179 Score = 116 bits (278), Expect = 2e-26 Identities = 47/80 (58%), Positives = 65/80 (81%) Frame = +1 Query: 247 HVKRPMNAFMVFAQAMRRRLSAERPSLHNAELSKSLGSMWKNLSEEEKLPFIKEADKLRT 426 HVKRPMNAFMV+++ RR+++ E P +HN+E+SK LGS WK L++++K PF++EA KLR Sbjct: 9 HVKRPMNAFMVWSREERRKIAQENPKMHNSEISKRLGSEWKQLADDDKKPFVEEAKKLRA 68 Query: 427 QHKKQHPDYKYQPRRRKPPL 486 QH K+HPDYKY+PRR+ L Sbjct: 69 QHMKEHPDYKYRPRRKPKSL 88 >SB_29734| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 304 Score = 113 bits (272), Expect = 8e-26 Identities = 46/79 (58%), Positives = 64/79 (81%) Frame = +1 Query: 247 HVKRPMNAFMVFAQAMRRRLSAERPSLHNAELSKSLGSMWKNLSEEEKLPFIKEADKLRT 426 HVKRPMNAFMV++Q RR+++ E P +HNAE+SK LG WK LSE EK PF++E+++LR Sbjct: 44 HVKRPMNAFMVWSQIERRKMAEEHPDMHNAEISKRLGKRWKLLSESEKRPFVEESERLRI 103 Query: 427 QHKKQHPDYKYQPRRRKPP 483 +H + +PDYKY+PR++K P Sbjct: 104 RHMQAYPDYKYRPRKKKQP 122 >SB_15122| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 709 Score = 111 bits (266), Expect = 4e-25 Identities = 51/91 (56%), Positives = 67/91 (73%), Gaps = 2/91 (2%) Frame = +1 Query: 244 PHVKRPMNAFMVFAQAMRRRLSAERPSLHNAELSKSLGSMWKNLSEEEKLPFIKEADKLR 423 P VKRPMN+FMV+AQ+ RR+L+ + P +HNAELSK LG +W+ LS EK P++ EA +L Sbjct: 109 PKVKRPMNSFMVWAQSARRKLAEQYPHVHNAELSKMLGKLWRMLSAAEKQPYVDEAARLD 168 Query: 424 TQHKKQHPDYKYQPRRRKPPL--ASASTPRV 510 +HK+ HPDYKY+PRRR+ L A PRV Sbjct: 169 KRHKEDHPDYKYRPRRRQKSLKRAYGQPPRV 199 >SB_13764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1099 Score = 108 bits (260), Expect = 2e-24 Identities = 46/79 (58%), Positives = 62/79 (78%) Frame = +1 Query: 250 VKRPMNAFMVFAQAMRRRLSAERPSLHNAELSKSLGSMWKNLSEEEKLPFIKEADKLRTQ 429 VKRPMNAFMV+++ RR+++ + P +HN+E+SK LGS WK LSE+EK P+I EA +LR Sbjct: 789 VKRPMNAFMVWSRERRRKMAQDNPKMHNSEISKRLGSEWKLLSEQEKRPYIDEARRLRAV 848 Query: 430 HKKQHPDYKYQPRRRKPPL 486 H K+HPDYKY+PRR+ L Sbjct: 849 HMKEHPDYKYRPRRKSKTL 867 >SB_26162| Best HMM Match : HMG_box (HMM E-Value=1.5e-31) Length = 367 Score = 106 bits (255), Expect = 1e-23 Identities = 41/76 (53%), Positives = 61/76 (80%) Frame = +1 Query: 247 HVKRPMNAFMVFAQAMRRRLSAERPSLHNAELSKSLGSMWKNLSEEEKLPFIKEADKLRT 426 HVKRPMN+FM++A+ MRR+ + E P LHNAE+SK LG W L+ ++K PF+++A++LR Sbjct: 93 HVKRPMNSFMIWAKVMRRKFAEENPKLHNAEISKLLGKAWNELTTKDKRPFVEKAERLRI 152 Query: 427 QHKKQHPDYKYQPRRR 474 +H K+HP+Y+Y P+RR Sbjct: 153 RHMKEHPNYRYTPKRR 168 >SB_3516| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 642 Score = 106 bits (254), Expect = 1e-23 Identities = 46/76 (60%), Positives = 59/76 (77%) Frame = +1 Query: 250 VKRPMNAFMVFAQAMRRRLSAERPSLHNAELSKSLGSMWKNLSEEEKLPFIKEADKLRTQ 429 +KRPMNAFMV+AQ RRRL+ P LHNAELSK LG W+ L+ +K PF+ EA++LR Q Sbjct: 366 IKRPMNAFMVWAQVERRRLADANPELHNAELSKMLGLTWRALNSTQKRPFVDEAERLRLQ 425 Query: 430 HKKQHPDYKYQPRRRK 477 H + +P+YKY+PRRRK Sbjct: 426 HMQDYPNYKYRPRRRK 441 >SB_27742| Best HMM Match : HMG_box (HMM E-Value=1.3e-24) Length = 201 Score = 104 bits (250), Expect = 4e-23 Identities = 44/77 (57%), Positives = 61/77 (79%) Frame = +1 Query: 247 HVKRPMNAFMVFAQAMRRRLSAERPSLHNAELSKSLGSMWKNLSEEEKLPFIKEADKLRT 426 H+KRPMNAFMV+++ RR+L+ + P++ N E+SK LG+ W LSEEEK PF+ EA +LRT Sbjct: 8 HIKRPMNAFMVWSRTERRKLALKYPNMLNCEISKLLGAEWSRLSEEEKRPFVTEAKRLRT 67 Query: 427 QHKKQHPDYKYQPRRRK 477 H +++PDY Y+PRRRK Sbjct: 68 IHNQKYPDYSYKPRRRK 84 >SB_24989| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 102 bits (245), Expect = 2e-22 Identities = 43/86 (50%), Positives = 62/86 (72%) Frame = +1 Query: 247 HVKRPMNAFMVFAQAMRRRLSAERPSLHNAELSKSLGSMWKNLSEEEKLPFIKEADKLRT 426 H+KRPMNA+MV+++ RRR++ E P + N+E+SK LG W +L+ +EK P+++EA +LR Sbjct: 7 HIKRPMNAYMVWSRKERRRIAEECPRMLNSEISKRLGLEWNSLTLDEKQPYVEEAKRLRE 66 Query: 427 QHKKQHPDYKYQPRRRKPPLASASTP 504 HKK HPDYKYQP+R+ TP Sbjct: 67 LHKKDHPDYKYQPKRKPKTSPKLKTP 92 >SB_40969| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 374 Score = 101 bits (243), Expect = 3e-22 Identities = 44/80 (55%), Positives = 59/80 (73%) Frame = +1 Query: 238 RRPHVKRPMNAFMVFAQAMRRRLSAERPSLHNAELSKSLGSMWKNLSEEEKLPFIKEADK 417 ++ HVKRPMN FMV+++ R ++ E P ++NA LSK LG WK LS EEK P+I++A Sbjct: 4 KKTHVKRPMNCFMVWSREKRCQILQENPGINNARLSKLLGMAWKKLSVEEKEPYIEKAKH 63 Query: 418 LRTQHKKQHPDYKYQPRRRK 477 L HK++HPDYKYQP+RRK Sbjct: 64 LTEMHKEKHPDYKYQPKRRK 83 >SB_41131| Best HMM Match : HMG_box (HMM E-Value=4.1e-28) Length = 245 Score = 100 bits (240), Expect = 6e-22 Identities = 41/76 (53%), Positives = 58/76 (76%) Frame = +1 Query: 247 HVKRPMNAFMVFAQAMRRRLSAERPSLHNAELSKSLGSMWKNLSEEEKLPFIKEADKLRT 426 HVKRP+N+FMV+A+ RR ++ E P + NAE+SK LG W+ + E EKLP+ +EA +LR Sbjct: 9 HVKRPLNSFMVWAKEKRRAMNRENPKMRNAEISKILGDEWRKMPESEKLPYTEEALRLRR 68 Query: 427 QHKKQHPDYKYQPRRR 474 QHK HP+Y+Y+PRR+ Sbjct: 69 QHKVDHPNYRYKPRRK 84 >SB_31139| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 315 Score = 100 bits (240), Expect = 6e-22 Identities = 43/78 (55%), Positives = 60/78 (76%) Frame = +1 Query: 247 HVKRPMNAFMVFAQAMRRRLSAERPSLHNAELSKSLGSMWKNLSEEEKLPFIKEADKLRT 426 HVKRPMNAFMV+++ RR S E P +HN+E+SK LG WK + +E K P+I++A +L+ Sbjct: 8 HVKRPMNAFMVWSKERRRIKSQECPRMHNSEISKILGCEWKAMKDELKQPYIEKAKELQA 67 Query: 427 QHKKQHPDYKYQPRRRKP 480 QH +++P YKY+PRRRKP Sbjct: 68 QHSRENPGYKYKPRRRKP 85 >SB_25642| Best HMM Match : HMG_box (HMM E-Value=1.3e-29) Length = 267 Score = 99 bits (238), Expect = 1e-21 Identities = 42/76 (55%), Positives = 56/76 (73%) Frame = +1 Query: 247 HVKRPMNAFMVFAQAMRRRLSAERPSLHNAELSKSLGSMWKNLSEEEKLPFIKEADKLRT 426 H+KRPMNAFM+++ RR+L+AE P LHN+++SK LG+ W+ L+ EEK F EA L Sbjct: 6 HIKRPMNAFMIWSSKKRRQLAAENPKLHNSQISKMLGTEWRKLTVEEKQKFFAEAKLLNE 65 Query: 427 QHKKQHPDYKYQPRRR 474 H +HPDYKY+PRRR Sbjct: 66 LHMIEHPDYKYRPRRR 81 >SB_10678| Best HMM Match : HMG_box (HMM E-Value=1.3e-29) Length = 494 Score = 99 bits (238), Expect = 1e-21 Identities = 42/76 (55%), Positives = 56/76 (73%) Frame = +1 Query: 247 HVKRPMNAFMVFAQAMRRRLSAERPSLHNAELSKSLGSMWKNLSEEEKLPFIKEADKLRT 426 H+KRPMNAFM+++ RR+L+AE P LHN+++SK LG+ W+ L+ EEK F EA L Sbjct: 6 HIKRPMNAFMIWSSKKRRQLAAENPKLHNSQISKMLGTEWRKLTVEEKQKFFAEAKLLNE 65 Query: 427 QHKKQHPDYKYQPRRR 474 H +HPDYKY+PRRR Sbjct: 66 LHMIEHPDYKYRPRRR 81 >SB_16422| Best HMM Match : HMG_box (HMM E-Value=8.7e-26) Length = 245 Score = 90.2 bits (214), Expect = 9e-19 Identities = 35/75 (46%), Positives = 58/75 (77%) Frame = +1 Query: 250 VKRPMNAFMVFAQAMRRRLSAERPSLHNAELSKSLGSMWKNLSEEEKLPFIKEADKLRTQ 429 +KRP+NAF+++++ RR ++ E P +HN ++S+ LG W+ L+EEEK + +EA KL+ + Sbjct: 19 IKRPLNAFILWSKKRRRVIANENPQMHNFDISRKLGLEWQKLTEEEKAYYFEEAKKLKEE 78 Query: 430 HKKQHPDYKYQPRRR 474 HK+++P YKYQPR+R Sbjct: 79 HKERYPHYKYQPRKR 93 >SB_52386| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 384 Score = 85.8 bits (203), Expect = 2e-17 Identities = 37/85 (43%), Positives = 55/85 (64%) Frame = +1 Query: 250 VKRPMNAFMVFAQAMRRRLSAERPSLHNAELSKSLGSMWKNLSEEEKLPFIKEADKLRTQ 429 VKRPMNAFM++A+ R ++ P +NAE+S LG +W +LS E++ P+ EA +L+ + Sbjct: 101 VKRPMNAFMIWARLHRSTIAKRYPQANNAEISIRLGEIWNDLSSEQQKPYFDEATRLKDK 160 Query: 430 HKKQHPDYKYQPRRRKPPLASASTP 504 HK +HP++ YQPR K TP Sbjct: 161 HKAEHPNWVYQPRPAKRRALQLGTP 185 >SB_16481| Best HMM Match : HMG_box (HMM E-Value=1.2e-08) Length = 271 Score = 72.1 bits (169), Expect = 3e-13 Identities = 34/65 (52%), Positives = 44/65 (67%), Gaps = 1/65 (1%) Frame = +1 Query: 247 HVKRPMNAFMVFAQAMRRRLSAERPSLHNAELSKSLGSMWKNLSEEEKLPFIKEADKL-R 423 HVK PMNAFMV ++ R+ ++ P +HN+E SKSLG WK L+ EEK PFI E +L R Sbjct: 8 HVKSPMNAFMVCSRGKRKHYASINPGMHNSEFSKSLGPEWKMLTSEEKDPFIAEPKRLQR 67 Query: 424 TQHKK 438 T H + Sbjct: 68 TSHAR 72 >SB_29576| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1202 Score = 68.9 bits (161), Expect = 2e-12 Identities = 34/97 (35%), Positives = 53/97 (54%), Gaps = 1/97 (1%) Frame = +1 Query: 223 GGGCMRRPHVKRPMNAFMVFAQAMRRRLSAERPSLHNAELSKSLGSMWKNLSEEEKLPFI 402 GG + H++RPMNAFM+F++ R + + P N +SK LG W L EEK + Sbjct: 507 GGNDDSKDHIRRPMNAFMIFSKRHRALVHQKHPHQDNRTVSKILGEWWYALGPEEKQSYN 566 Query: 403 KEADKLRTQHKKQHPDYKYQPR-RRKPPLASASTPRV 510 A +++ H K HPD+K+ + R+K P S + + Sbjct: 567 ALAAQVKEAHFKAHPDWKWCTKDRKKSPRKSTDSAEI 603 >SB_12646| Best HMM Match : SSrecog (HMM E-Value=0) Length = 783 Score = 48.0 bits (109), Expect = 5e-06 Identities = 26/101 (25%), Positives = 50/101 (49%), Gaps = 2/101 (1%) Frame = +1 Query: 220 KGGGCMRRPHV-KRPMNAFMVFAQAMRRRLSAERPSLHNAELSKSLGSMWKNLSEEEKLP 396 KGG + P+ KR M+A+M++ R+ + + P + E+SK G MWKNL+++ K Sbjct: 531 KGGKKKKDPNAPKRAMSAYMLWLNDTRQEIKDKNPGISVTEVSKVAGEMWKNLTDKSKWE 590 Query: 397 FIKEADKLR-TQHKKQHPDYKYQPRRRKPPLASASTPRVKR 516 +K + Q K++ + K + P + + + + Sbjct: 591 EKAAIEKQKYVQRMKEYNENKKNDKEESSPKKKSPSKKASK 631 >SB_21901| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 192 Score = 47.2 bits (107), Expect = 8e-06 Identities = 24/71 (33%), Positives = 36/71 (50%) Frame = +1 Query: 253 KRPMNAFMVFAQAMRRRLSAERPSLHNAELSKSLGSMWKNLSEEEKLPFIKEADKLRTQH 432 K +A+ F Q R +L E A+ SK WKN+SEEEK F+++A K + + Sbjct: 13 KGAKSAYNFFLQDQREKLQREEGKFSLADFSKVSAEKWKNMSEEEKETFVQKAGKDKERF 72 Query: 433 KKQHPDYKYQP 465 K++ Y P Sbjct: 73 KEEMQSYTPPP 83 Score = 38.7 bits (86), Expect = 0.003 Identities = 17/68 (25%), Positives = 35/68 (51%) Frame = +1 Query: 253 KRPMNAFMVFAQAMRRRLSAERPSLHNAELSKSLGSMWKNLSEEEKLPFIKEADKLRTQH 432 KR ++A+ F R + + P+ LSK LG MW +++++K + A K + ++ Sbjct: 103 KRCLSAYFHFINLKRDDVKKDNPNASGGALSKVLGEMWSKMTDDDKTQYQDMAKKDKVRY 162 Query: 433 KKQHPDYK 456 + + +K Sbjct: 163 ESEMKAFK 170 >SB_23256| Best HMM Match : HMG_box (HMM E-Value=3.3e-22) Length = 523 Score = 47.2 bits (107), Expect = 8e-06 Identities = 20/68 (29%), Positives = 40/68 (58%) Frame = +1 Query: 253 KRPMNAFMVFAQAMRRRLSAERPSLHNAELSKSLGSMWKNLSEEEKLPFIKEADKLRTQH 432 K P+ ++ F R ++ +E P L E+++ LG+MW L +K F++EA+K + ++ Sbjct: 178 KAPLTGYVRFLNEHREKVRSENPDLPFHEVTRILGNMWSQLPTPQKQLFLEEAEKDKERY 237 Query: 433 KKQHPDYK 456 K+ +Y+ Sbjct: 238 MKELEEYQ 245 >SB_1832| Best HMM Match : HMG_box (HMM E-Value=1.7e-22) Length = 299 Score = 46.4 bits (105), Expect = 1e-05 Identities = 21/81 (25%), Positives = 47/81 (58%), Gaps = 1/81 (1%) Frame = +1 Query: 253 KRPMNAFMVFAQAMRRRLSAERPSLHNAELSKSLGSMWKNLSEEEKLPFIKEADKLRTQH 432 K P+ ++ + Q R +L+ + P+L + EL+ L W+ +SEE K + ++ ++ + ++ Sbjct: 153 KMPLTSYFRYCQKHRAKLAKKYPNLKSTELAAKLSKKWRKMSEERKKAYTEQYEEEKKEY 212 Query: 433 KKQHPDY-KYQPRRRKPPLAS 492 + Q D+ K + +PPL++ Sbjct: 213 ETQLLDFLKNKYPNVEPPLSA 233 Score = 43.2 bits (97), Expect = 1e-04 Identities = 22/66 (33%), Positives = 36/66 (54%), Gaps = 1/66 (1%) Frame = +1 Query: 244 PHVKRPMNAFMVFAQAMRRRLSAERPSLHNAELSKSLGSMWKNLSEEEKLPFI-KEADKL 420 P+V+ P++AF ++A R+ L P + +L K L WK + E+ K +I KE ++ Sbjct: 225 PNVEPPLSAFELWANQARKDLLVSNPDISAKKLKKKLKRKWKEIDEKGKKTWIKKEKTEM 284 Query: 421 RTQHKK 438 R KK Sbjct: 285 RKYQKK 290 >SB_18968| Best HMM Match : HMG_box (HMM E-Value=1.2e-19) Length = 1204 Score = 45.6 bits (103), Expect = 3e-05 Identities = 19/83 (22%), Positives = 44/83 (53%) Frame = +1 Query: 256 RPMNAFMVFAQAMRRRLSAERPSLHNAELSKSLGSMWKNLSEEEKLPFIKEADKLRTQHK 435 +P++A+ +F + + + + PS E++K +G MW+NL EE+K + + + + +++ Sbjct: 927 KPLSAYQIFFKETQAAIRLQNPSAQFGEIAKIVGQMWENLPEEQKKVYHCKHETAKAEYQ 986 Query: 436 KQHPDYKYQPRRRKPPLASASTP 504 K + + + K L +P Sbjct: 987 KAMDELISKQKEPKAKLPKLESP 1009 >SB_16438| Best HMM Match : HMG_box (HMM E-Value=7.2e-31) Length = 690 Score = 44.4 bits (100), Expect = 6e-05 Identities = 30/90 (33%), Positives = 46/90 (51%), Gaps = 8/90 (8%) Frame = +1 Query: 244 PHVKRPMNAFMVFAQAMRRRLSAER-----PSLHNAELSKSLGSMWKNLSEEEKLPFI-- 402 P VKR +A++ F R +L A+ P E++K G WK L++E+K P++ Sbjct: 494 PVVKRASSAYIHFTSDFRAKLKAKSAKSGTPLPKANEVAKLAGEEWKKLNDEQKKPYVAK 553 Query: 403 KEADKLRTQHKKQHPDYKYQP-RRRKPPLA 489 EADK R + D K P + ++PP A Sbjct: 554 AEADKQRYLKESGKNDPKKDPDKPKRPPTA 583 Score = 37.9 bits (84), Expect = 0.005 Identities = 21/70 (30%), Positives = 44/70 (62%), Gaps = 2/70 (2%) Frame = +1 Query: 253 KRPMNAFMVFAQAMRRRLSAERPSLHNAELSKSL-GSMWKNLSEEEKLPF-IKEADKLRT 426 KRP A+ +F A R+ ++ + +L + + SL G W+ +S+E+K P+ I+EA++ R Sbjct: 578 KRPPTAYFLFLAAFRKEMAGK--ALEDGKKIPSLAGERWREMSDEDKKPYTIQEAEE-RN 634 Query: 427 QHKKQHPDYK 456 +++K +++ Sbjct: 635 KYEKVMEEWR 644 >SB_7134| Best HMM Match : HMG_box (HMM E-Value=2e-16) Length = 228 Score = 43.6 bits (98), Expect = 1e-04 Identities = 29/94 (30%), Positives = 46/94 (48%), Gaps = 7/94 (7%) Frame = +1 Query: 253 KRPMNAFMVFAQAMRRRLSAERPS----LHNAELSKSLGSMWKNLSEEEKLPFIK--EAD 414 K+P NAF +F Q R + + + + EL+KSL W NL +EK + + E D Sbjct: 56 KKPANAFFMFCQQQRTVMQEDHKDATAVMGHHELTKSLAKEWNNLLPDEKKVYYEMYERD 115 Query: 415 KLRTQ-HKKQHPDYKYQPRRRKPPLASASTPRVK 513 K R + KQ+ K +++K P + P+ K Sbjct: 116 KERYELEMKQYSSDKPPSKKQKDPSSKKRKPKGK 149 >SB_23680| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 548 Score = 43.2 bits (97), Expect = 1e-04 Identities = 26/77 (33%), Positives = 34/77 (44%) Frame = +1 Query: 253 KRPMNAFMVFAQAMRRRLSAERPSLHNAELSKSLGSMWKNLSEEEKLPFIKEADKLRTQH 432 KRP AF F Q ++ E P L +AE+ K L W NL P +KE + Q Sbjct: 307 KRPTPAFFRFRQDYADKVKEENPHLKDAEIRKHLSDQWANLE-----PSVKECYRKEYQQ 361 Query: 433 KKQHPDYKYQPRRRKPP 483 + Y+ RKPP Sbjct: 362 DMEEFRAPYKKLPRKPP 378 >SB_9716| Best HMM Match : HMG_box (HMM E-Value=0.0041) Length = 169 Score = 40.3 bits (90), Expect = 0.001 Identities = 17/41 (41%), Positives = 27/41 (65%) Frame = +1 Query: 328 HNAELSKSLGSMWKNLSEEEKLPFIKEADKLRTQHKKQHPD 450 H A +S LG WK++ +EE+ ++ EA +L +HKK +PD Sbjct: 109 HRA-ISVILGDKWKSMKQEERKQYVMEAKQLAEEHKKVNPD 148 Score = 32.3 bits (70), Expect = 0.25 Identities = 13/29 (44%), Positives = 19/29 (65%) Frame = +1 Query: 253 KRPMNAFMVFAQAMRRRLSAERPSLHNAE 339 KRPMNAFM+FA+ R ++ P N++ Sbjct: 32 KRPMNAFMLFAKRYRLEITQAHPGKDNSQ 60 >SB_37758| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 382 Score = 36.7 bits (81), Expect = 0.012 Identities = 17/62 (27%), Positives = 34/62 (54%) Frame = +1 Query: 271 FMVFAQAMRRRLSAERPSLHNAELSKSLGSMWKNLSEEEKLPFIKEADKLRTQHKKQHPD 450 ++ F + R + + P L E++K LG W +L EEK F+ EA++ + ++ ++ Sbjct: 204 YVRFLNSRRESVKHQHPHLTFPEITKMLGQEWNSLLPEEKQKFLDEAEEDKKRYVEELRA 263 Query: 451 YK 456 Y+ Sbjct: 264 YQ 265 >SB_606| Best HMM Match : HMG_box (HMM E-Value=0.19) Length = 159 Score = 35.9 bits (79), Expect = 0.020 Identities = 16/43 (37%), Positives = 25/43 (58%) Frame = +1 Query: 331 NAELSKSLGSMWKNLSEEEKLPFIKEADKLRTQHKKQHPDYKY 459 N ++S LG W +SE K PF + A +L + K +P++KY Sbjct: 4 NRKISIMLGDYWNCMSEGHKRPFQEMARELMRKTKATYPEFKY 46 >SB_46509| Best HMM Match : HMG_box (HMM E-Value=4.2e-10) Length = 145 Score = 35.5 bits (78), Expect = 0.027 Identities = 16/59 (27%), Positives = 29/59 (49%) Frame = +1 Query: 253 KRPMNAFMVFAQAMRRRLSAERPSLHNAELSKSLGSMWKNLSEEEKLPFIKEADKLRTQ 429 KR + +++F+ MR + E P E+S+ +G W+N S K + +A +Q Sbjct: 36 KRGQSGYLLFSHEMRGIIRKEHPEYAFGEISRLIGEEWRNASAARKAEYENKAQMQLSQ 94 >SB_12182| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1361 Score = 35.5 bits (78), Expect = 0.027 Identities = 16/59 (27%), Positives = 29/59 (49%) Frame = +1 Query: 253 KRPMNAFMVFAQAMRRRLSAERPSLHNAELSKSLGSMWKNLSEEEKLPFIKEADKLRTQ 429 KR + +++F+ MR + E P E+S+ +G W+N S K + +A +Q Sbjct: 1269 KRGQSGYLLFSHEMRGIIRKEHPEYAFGEISRLIGEEWRNASAARKAEYENKAQMQLSQ 1327 >SB_25919| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 33.5 bits (73), Expect = 0.11 Identities = 15/39 (38%), Positives = 26/39 (66%) Frame = +1 Query: 403 KEADKLRTQHKKQHPDYKYQPRRRKPPLASASTPRVKRE 519 +EA +LRT+++++H Y QP+ + P LA + R+K E Sbjct: 21 QEAAELRTKNEEEHMKYGSQPKWKIPLLARQESDRLKEE 59 >SB_8660| Best HMM Match : Carboxyl_trans (HMM E-Value=0) Length = 1311 Score = 32.7 bits (71), Expect = 0.19 Identities = 12/17 (70%), Positives = 16/17 (94%) Frame = +1 Query: 247 HVKRPMNAFMVFAQAMR 297 HVKRPMN+FM++A+ MR Sbjct: 1294 HVKRPMNSFMIWAKVMR 1310 >SB_30587| Best HMM Match : IncA (HMM E-Value=0.42) Length = 272 Score = 30.7 bits (66), Expect = 0.76 Identities = 17/49 (34%), Positives = 26/49 (53%) Frame = +1 Query: 325 LHNAELSKSLGSMWKNLSEEEKLPFIKEADKLRTQHKKQHPDYKYQPRR 471 LH A++S+ + K SE+EKLP + K K+ P YK Q ++ Sbjct: 155 LHIADVSRKIPEEIKEFSEKEKLPSSQNKMKDLQAMLKKAPQYKDQVKK 203 >SB_13394| Best HMM Match : Chordopox_A13L (HMM E-Value=3.2) Length = 694 Score = 30.3 bits (65), Expect = 1.0 Identities = 22/76 (28%), Positives = 32/76 (42%) Frame = +3 Query: 141 GQAGDKRGRRKTRENI*LRYNTAATNERWWVYASSTRQETDECIHGVRASDAPPFVGRTT 320 G+ + G+R+ E+ LR N W R ECIH AS P +V + Sbjct: 535 GKQERRSGKREMVESDELRQILWPCNVEWLNENMVKRSREGECIHFAAASAGPIYVVFSL 594 Query: 321 LPAQRRTQQIIRIHVE 368 P+ + T +RI E Sbjct: 595 NPSNKDTWYHLRIGQE 610 >SB_4907| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 792 Score = 30.3 bits (65), Expect = 1.0 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = +1 Query: 430 HKKQHPDYKYQPRRRKPPLASASTPRVKR 516 HK +HP+ P R +P + +AS P V + Sbjct: 122 HKNKHPNLSISPPRSEPEMENASKPEVAK 150 >SB_26483| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1702 Score = 29.9 bits (64), Expect = 1.3 Identities = 18/56 (32%), Positives = 25/56 (44%) Frame = +3 Query: 159 RGRRKTRENI*LRYNTAATNERWWVYASSTRQETDECIHGVRASDAPPFVGRTTLP 326 R RKT+E + +A+T E + A R+ T E +H PP TLP Sbjct: 835 RAGRKTKEGAIIPATSASTTESATLVADIVRRVTAEQVHPAAIPGNPPVPPLETLP 890 >SB_22143| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1995 Score = 29.5 bits (63), Expect = 1.8 Identities = 12/37 (32%), Positives = 23/37 (62%) Frame = +1 Query: 340 LSKSLGSMWKNLSEEEKLPFIKEADKLRTQHKKQHPD 450 +++SLG++ K + E+ P+I + DKL+ K+ D Sbjct: 463 VAESLGTLTKLIGEKAMTPYIDKLDKLKADKVKEFAD 499 >SB_53479| Best HMM Match : Zot (HMM E-Value=1.1) Length = 251 Score = 29.1 bits (62), Expect = 2.3 Identities = 9/21 (42%), Positives = 18/21 (85%) Frame = +1 Query: 247 HVKRPMNAFMVFAQAMRRRLS 309 H+K+P+NAFM++ + MR +++ Sbjct: 227 HIKKPLNAFMLYMKDMRPKVA 247 >SB_25447| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 752 Score = 29.1 bits (62), Expect = 2.3 Identities = 14/34 (41%), Positives = 20/34 (58%) Frame = -3 Query: 210 RQYCIVVKYFHEFSDGLVYLQLVPGPVALLAPTH 109 R Y +VKYF + +G Y++ G V LL+P H Sbjct: 608 RSYRFIVKYFDKTENG--YVEAGKGEVLLLSPRH 639 >SB_27114| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 116 Score = 29.1 bits (62), Expect = 2.3 Identities = 19/61 (31%), Positives = 26/61 (42%) Frame = +1 Query: 253 KRPMNAFMVFAQAMRRRLSAERPSLHNAELSKSLGSMWKNLSEEEKLPFIKEADKLRTQH 432 KRP N+ A R + P H A + +WK +SEE P K KL+ + Sbjct: 16 KRPKNSPPEGADPKNRIKTNPEPETHEAIYEE----IWKEISEEHPPPLPKRGPKLKQRS 71 Query: 433 K 435 K Sbjct: 72 K 72 >SB_12475| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 648 Score = 28.7 bits (61), Expect = 3.1 Identities = 21/69 (30%), Positives = 28/69 (40%) Frame = +3 Query: 162 GRRKTRENI*LRYNTAATNERWWVYASSTRQETDECIHGVRASDAPPFVGRTTLPAQRRT 341 G+R+ E LR N W R ECIH AS P +V + P+ + T Sbjct: 246 GKREMVERDELRQILWPCNVEWLNENMVKRSRKGECIHFAAASAGPIYVVFSLNPSNKDT 305 Query: 342 QQIIRIHVE 368 +RI E Sbjct: 306 WYHLRIGQE 314 >SB_2026| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1789 Score = 28.7 bits (61), Expect = 3.1 Identities = 13/59 (22%), Positives = 32/59 (54%), Gaps = 2/59 (3%) Frame = +1 Query: 271 FMVFAQAMRRRLSAERPSLHNAELSKSLGSMWKNL--SEEEKLPFIKEADKLRTQHKKQ 441 ++ F +AMR +++ P + + ++ LG+MW++ ++ P + + K + KK+ Sbjct: 299 YVKFTKAMRPAVASANPGVAHTRINALLGAMWQDFKTAQGPSSPASRSSSKKSSAKKKK 357 >SB_27115| Best HMM Match : SAM_1 (HMM E-Value=1.7e-08) Length = 527 Score = 28.7 bits (61), Expect = 3.1 Identities = 19/61 (31%), Positives = 26/61 (42%) Frame = +1 Query: 253 KRPMNAFMVFAQAMRRRLSAERPSLHNAELSKSLGSMWKNLSEEEKLPFIKEADKLRTQH 432 KRP N+ A R + P H A + +WK +SEE P K KL+ + Sbjct: 10 KRPENSPPEGADPKNRIKTNPEPETHEAIYEE----IWKEISEEHPPPLPKRGPKLKQRS 65 Query: 433 K 435 K Sbjct: 66 K 66 >SB_11329| Best HMM Match : DUF1151 (HMM E-Value=0.0015) Length = 746 Score = 28.7 bits (61), Expect = 3.1 Identities = 21/66 (31%), Positives = 35/66 (53%), Gaps = 1/66 (1%) Frame = +1 Query: 298 RRLSAERPSLHNAELSKSLGSMWKNLSEEEKLPFIKEADKLRTQHKKQHPDY-KYQPRRR 474 ++ + E SL+ +ELS L ++ K L EEE R Q++++ P++ K R+ Sbjct: 691 KKTAKEMESLNESELSAKLKTISKKLEEEEH----------RKQNEEKKPEFMKVNLRKA 740 Query: 475 KPPLAS 492 KP AS Sbjct: 741 KPQTAS 746 >SB_30665| Best HMM Match : F5_F8_type_C (HMM E-Value=2.5e-19) Length = 578 Score = 28.3 bits (60), Expect = 4.1 Identities = 21/69 (30%), Positives = 28/69 (40%) Frame = +3 Query: 162 GRRKTRENI*LRYNTAATNERWWVYASSTRQETDECIHGVRASDAPPFVGRTTLPAQRRT 341 G+R+ E LR N W R ECIH AS P +V + P+ + T Sbjct: 156 GKREMVERDELRQILWPCNVEWLNENMVKRSREGECIHFAAASAGPIYVVFSWNPSNKDT 215 Query: 342 QQIIRIHVE 368 +RI E Sbjct: 216 WYHLRIGQE 224 >SB_29861| Best HMM Match : RRM_1 (HMM E-Value=1.10002e-42) Length = 1531 Score = 28.3 bits (60), Expect = 4.1 Identities = 23/109 (21%), Positives = 38/109 (34%) Frame = +1 Query: 187 FDYDTILPQPTKGGGCMRRPHVKRPMNAFMVFAQAMRRRLSAERPSLHNAELSKSLGSMW 366 F+ D LP+ + + + H + P + + R N E + Sbjct: 726 FEKDVPLPRVHEEQDQVEKEHRRTPDGTQEPYEKHRRPSFDDNEEECENGEDKARKVEVE 785 Query: 367 KNLSEEEKLPFIKEADKLRTQHKKQHPDYKYQPRRRKPPLASASTPRVK 513 K LS EE+ P R + K++H ++ P PP P K Sbjct: 786 KRLSREERDPSRSPWASHREERKRRHTPHEDSPPPPPPPPPPPEEPSNK 834 >SB_39468| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1778 Score = 27.9 bits (59), Expect = 5.4 Identities = 16/43 (37%), Positives = 22/43 (51%), Gaps = 1/43 (2%) Frame = +2 Query: 269 HSWCSRKRCAAVCRPNDPPCTTPNSANH*DPCGKI*AKR-RSC 394 H+W RKRCA P + T+ ++ PCG KR R+C Sbjct: 1408 HAWIERKRCALPDCPVNGNYTSWSAWTECQPCGLGVRKRGRTC 1450 >SB_6267| Best HMM Match : DUF930 (HMM E-Value=3.6) Length = 502 Score = 27.9 bits (59), Expect = 5.4 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +2 Query: 278 CSRKRCAAVCRPNDPPCTTPNSAN 349 C K CA+ CR + PC+ +S N Sbjct: 479 CQHKGCASGCRQHHGPCSEGDSGN 502 >SB_20773| Best HMM Match : DNA_pol_B_exo (HMM E-Value=2.5e-37) Length = 1652 Score = 27.5 bits (58), Expect = 7.1 Identities = 14/47 (29%), Positives = 27/47 (57%), Gaps = 1/47 (2%) Frame = -3 Query: 183 FHEFSDGLVYLQL-VPGPVALLAPTHGHFQR*NGILFEKKMNIFIIE 46 +H +SD + + +PG LLA T+ F+ I+F + ++F+I+ Sbjct: 1505 YHSYSDNKAMIGVFMPGQRKLLASTNDFFKSTMPIVFYFQSSVFVID 1551 >SB_53736| Best HMM Match : Borrelia_orfA (HMM E-Value=0.64) Length = 520 Score = 27.1 bits (57), Expect = 9.4 Identities = 20/63 (31%), Positives = 32/63 (50%), Gaps = 4/63 (6%) Frame = +1 Query: 340 LSKSLGSMWKNLSEEEKLPFIKEADKLRTQHKK---QHPDYK-YQPRRRKPPLASASTPR 507 L K ++K + E+ L KEAD+L ++HK+ Q+ D K + R+K + R Sbjct: 223 LEKKENELFKEIKEQAHLS-AKEADRLMSKHKEDLDQYADKKAREMERQKAQIKERLLER 281 Query: 508 VKR 516 KR Sbjct: 282 RKR 284 >SB_33520| Best HMM Match : 7tm_1 (HMM E-Value=7.3e-09) Length = 317 Score = 27.1 bits (57), Expect = 9.4 Identities = 10/27 (37%), Positives = 18/27 (66%) Frame = -3 Query: 219 RWLRQYCIVVKYFHEFSDGLVYLQLVP 139 R + QYCI++ + + F++ LVY +P Sbjct: 239 RQIYQYCIILLHVNSFANFLVYSYRIP 265 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,113,223 Number of Sequences: 59808 Number of extensions: 366531 Number of successful extensions: 1039 Number of sequences better than 10.0: 53 Number of HSP's better than 10.0 without gapping: 975 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1037 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1172759136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -