BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS312G02f (521 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_04_0143 + 17670103-17670430,17670511-17670785,17670897-176713... 28 4.0 09_02_0157 + 5083771-5083996,5084007-5084326,5085958-5086392,508... 27 6.9 >03_04_0143 + 17670103-17670430,17670511-17670785,17670897-17671376, 17671454-17671849,17673215-17673289,17673939-17673960, 17674041-17674129,17675204-17675495,17676019-17676087, 17676394-17676572 Length = 734 Score = 28.3 bits (60), Expect = 4.0 Identities = 17/49 (34%), Positives = 24/49 (48%) Frame = -1 Query: 263 IKNRHFSLINLKSTLYLQSLFRDF*VFVSKP*HLVVILLFSGHFLFLAF 117 IK + + L+ K L L SL DF +P +VV S H L++ F Sbjct: 552 IKEKVWKLLGEKEELELSSLSHDFRRLNLEPKEIVVATFSSSHNLWICF 600 >09_02_0157 + 5083771-5083996,5084007-5084326,5085958-5086392, 5087277-5087921 Length = 541 Score = 27.5 bits (58), Expect = 6.9 Identities = 15/35 (42%), Positives = 21/35 (60%), Gaps = 3/35 (8%) Frame = +3 Query: 15 CLTSSERGGSSSKYDVGISGKC---PI*RSNKRNQ 110 C+T+ GG YD+G+SG C I +SNKR + Sbjct: 28 CITAG-MGGVIFGYDIGVSGACLQLQIGQSNKRGK 61 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,836,295 Number of Sequences: 37544 Number of extensions: 149502 Number of successful extensions: 286 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 284 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 286 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1142636160 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -