BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS312F12f (521 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_01_0327 - 2942640-2943456,2944386-2944515,2944679-2944811 29 2.3 05_03_0667 + 16781857-16782001,16784506-16784544,16785229-167859... 28 4.0 02_02_0307 - 8809724-8811589,8811681-8811762,8812130-8812242,881... 28 4.0 03_05_0884 - 28487013-28487271,28487355-28487516,28487594-284878... 27 6.9 03_01_0436 + 3384526-3385236,3387857-3388720 27 9.1 >08_01_0327 - 2942640-2943456,2944386-2944515,2944679-2944811 Length = 359 Score = 29.1 bits (62), Expect = 2.3 Identities = 14/32 (43%), Positives = 19/32 (59%) Frame = -1 Query: 116 NCCRQAKVPAHLCSVDEDCETRMRVLAENGYG 21 +CC Q KV L S +ED E +R + +GYG Sbjct: 5 SCCNQQKVKRGLWSPEED-EKLIRYITTHGYG 35 >05_03_0667 + 16781857-16782001,16784506-16784544,16785229-16785910, 16786003-16786087,16786747-16786888,16787391-16787575, 16788011-16788143,16788317-16788405,16788530-16788604, 16789060-16789173,16789264-16789305 Length = 576 Score = 28.3 bits (60), Expect = 4.0 Identities = 15/51 (29%), Positives = 25/51 (49%), Gaps = 1/51 (1%) Frame = +3 Query: 216 ARGVLHSYFFSWEHAPT-RSLEVDWLDARNICRRHCMDAVSLETPQENEFV 365 A G H S H + S++ D+LDA+++ R +D V+ P E + Sbjct: 108 AEGFSHMLISSLRHLKSVESVQKDFLDAKHLAARLILDIVASIVPHEERIL 158 >02_02_0307 - 8809724-8811589,8811681-8811762,8812130-8812242, 8812361-8812492,8812681-8812864,8813002-8813135, 8813552-8813656,8813738-8813839,8813930-8814022, 8814136-8814456,8814595-8814696,8814791-8814853, 8815213-8815708,8815964-8816124,8816213-8816743, 8817077-8817118,8817203-8817334,8817639-8817703, 8817858-8818169,8818262-8818334,8818425-8818517, 8819440-8819501,8819740-8819809 Length = 1777 Score = 28.3 bits (60), Expect = 4.0 Identities = 14/45 (31%), Positives = 22/45 (48%) Frame = -2 Query: 331 TASMQCLRQMFLASSQSTSKLRVGACSQLKKYECSTPRASRYVEW 197 + +Q L+ S ST+ +R L+K EC PR +R + W Sbjct: 527 SGGVQRLQSSPQESEYSTNFVRKIMTDSLQKLECEAPRETRPIRW 571 >03_05_0884 - 28487013-28487271,28487355-28487516,28487594-28487802, 28488490-28488630,28488876-28489071,28489207-28489379, 28490095-28490142,28490301-28490378,28490526-28490792, 28491689-28491842,28491928-28492064,28492459-28492536, 28493039-28493216,28493589-28493803,28494063-28494422, 28494497-28494973,28495561-28495665,28495838-28496020, 28496105-28496263,28496937-28497154,28497737-28497905, 28498262-28498568,28498699-28498826,28498902-28499060, 28499194-28499364,28500258-28500376,28500604-28500853, 28501007-28501759 Length = 1950 Score = 27.5 bits (58), Expect = 6.9 Identities = 13/39 (33%), Positives = 19/39 (48%) Frame = +1 Query: 4 QSSTRPP*PFSASTRIRVSQSSSTLQR*AGTFAWRQQFC 120 QS+ P P S S S S+ LQ +G + W ++C Sbjct: 578 QSNQTPAKPVSTSLNTMESISAIALQAVSGPYMWNSEWC 616 >03_01_0436 + 3384526-3385236,3387857-3388720 Length = 524 Score = 27.1 bits (57), Expect = 9.1 Identities = 19/52 (36%), Positives = 22/52 (42%) Frame = +1 Query: 100 AWRQQFCSRHYASLRPRDV*LYQIPGVVPTEYAIRHTAMHGEYYIRISLAGN 255 AW + YA RPR V L + G P A H A E R LAG+ Sbjct: 68 AWCCAAAAYAYAMSRPRPVYLVDLAGYKP---AASHEATRAESIRRFGLAGD 116 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,450,012 Number of Sequences: 37544 Number of extensions: 359103 Number of successful extensions: 968 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 927 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 968 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1142636160 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -