BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS312F10f (521 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_02_0783 + 11151007-11151343,11153375-11153530,11153898-11153992 27 6.9 12_01_1063 + 10974522-10974776,10975094-10975599,10976243-109763... 27 9.1 >03_02_0783 + 11151007-11151343,11153375-11153530,11153898-11153992 Length = 195 Score = 27.5 bits (58), Expect = 6.9 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = -2 Query: 304 ILDLDVLKLGHVTEHRHPALLEGFFKTV 221 +++ D L HV +HR AL E FFKT+ Sbjct: 127 VIEDDTLIPKHVPQHRPVALPEEFFKTL 154 >12_01_1063 + 10974522-10974776,10975094-10975599,10976243-10976321, 10976337-10976633,10976712-10976976,10977055-10977425 Length = 590 Score = 27.1 bits (57), Expect = 9.1 Identities = 15/40 (37%), Positives = 20/40 (50%) Frame = +2 Query: 203 QLHAWGDSLKEAFEQCGMAMFGYMTELEYVQIKDVHTIEA 322 QL WG AFE+ M G +LE + DVH ++A Sbjct: 533 QLVKWGRRSSVAFERATSVMKGLRNQLEEIP-ADVHGLDA 571 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,252,086 Number of Sequences: 37544 Number of extensions: 221364 Number of successful extensions: 463 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 458 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 463 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1142636160 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -