BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS312F05f (521 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. 27 0.38 AY146758-1|AAO12073.1| 289|Anopheles gambiae odorant-binding pr... 25 1.5 AJ618930-1|CAF02010.2| 273|Anopheles gambiae odorant-binding pr... 25 1.5 AF393485-1|AAL60410.1| 289|Anopheles gambiae odorant binding pr... 25 1.5 CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskel... 24 3.6 AY843205-1|AAX14774.1| 478|Anopheles gambiae odorant receptor O... 23 6.2 AY363726-1|AAR14939.1| 331|Anopheles gambiae seven transmembran... 23 6.2 AY363725-1|AAR14938.1| 478|Anopheles gambiae seven transmembran... 23 6.2 >AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. Length = 1009 Score = 27.1 bits (57), Expect = 0.38 Identities = 14/31 (45%), Positives = 19/31 (61%) Frame = -1 Query: 272 YVYNQFGGKVLPHFVFLHLFGFYDAQMLNSS 180 YVY F GK PHF L+GF Q++N++ Sbjct: 761 YVYYDFYGKDNPHFHVPSLYGF--QQVVNNT 789 >AY146758-1|AAO12073.1| 289|Anopheles gambiae odorant-binding protein AgamOBP30 protein. Length = 289 Score = 25.0 bits (52), Expect = 1.5 Identities = 14/38 (36%), Positives = 22/38 (57%), Gaps = 6/38 (15%) Frame = +1 Query: 40 NNYHSD--FKEAKDS----LRSALRDQCQKVKRCVLQC 135 NNY ++ F+E D+ LRS +D+C + R V +C Sbjct: 239 NNYANETVFRETTDACYQRLRSDCQDECTLIARYVREC 276 >AJ618930-1|CAF02010.2| 273|Anopheles gambiae odorant-binding protein OBPjj83c protein. Length = 273 Score = 25.0 bits (52), Expect = 1.5 Identities = 14/38 (36%), Positives = 22/38 (57%), Gaps = 6/38 (15%) Frame = +1 Query: 40 NNYHSD--FKEAKDS----LRSALRDQCQKVKRCVLQC 135 NNY ++ F+E D+ LRS +D+C + R V +C Sbjct: 223 NNYANETVFRETTDACYQRLRSDCQDECTLIARYVREC 260 >AF393485-1|AAL60410.1| 289|Anopheles gambiae odorant binding protein 1 protein. Length = 289 Score = 25.0 bits (52), Expect = 1.5 Identities = 14/38 (36%), Positives = 22/38 (57%), Gaps = 6/38 (15%) Frame = +1 Query: 40 NNYHSD--FKEAKDS----LRSALRDQCQKVKRCVLQC 135 NNY ++ F+E D+ LRS +D+C + R V +C Sbjct: 239 NNYANETVFRETTDACYQRLRSDCQDECTLIARYVREC 276 >CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskeletal structural protein protein. Length = 1645 Score = 23.8 bits (49), Expect = 3.6 Identities = 20/90 (22%), Positives = 37/90 (41%), Gaps = 8/90 (8%) Frame = +3 Query: 27 PEYQQQLPFRFQRGERQPSFCSQRPMPESKTLRPTMSK--ESDRLPCYLQRKLRRIQH-- 194 P Y QQ + Q PS+ Q+ +P K + ++ + ++ +L ++H Sbjct: 380 PSYTQQQQQQQQSAAAPPSYWKQKKLPTKKQHKQLQAQLDKLTQINIHLHALFSAVEHGH 439 Query: 195 ----LRIVEAKKMQKNEMRKDFATKLVVNV 272 I+E+ + N + D T L V V Sbjct: 440 LEKARTILESTDVDVNSLNSDGLTPLDVAV 469 >AY843205-1|AAX14774.1| 478|Anopheles gambiae odorant receptor Or83b protein. Length = 478 Score = 23.0 bits (47), Expect = 6.2 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = -2 Query: 46 SCCWYSGNRIKKTF 5 SC WY G+ KTF Sbjct: 420 SCHWYDGSEEAKTF 433 >AY363726-1|AAR14939.1| 331|Anopheles gambiae seven transmembrane G protein-coupledreceptor protein. Length = 331 Score = 23.0 bits (47), Expect = 6.2 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = -2 Query: 46 SCCWYSGNRIKKTF 5 SC WY G+ KTF Sbjct: 273 SCHWYDGSEEAKTF 286 >AY363725-1|AAR14938.1| 478|Anopheles gambiae seven transmembrane G protein-coupledreceptor protein. Length = 478 Score = 23.0 bits (47), Expect = 6.2 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = -2 Query: 46 SCCWYSGNRIKKTF 5 SC WY G+ KTF Sbjct: 420 SCHWYDGSEEAKTF 433 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 544,245 Number of Sequences: 2352 Number of extensions: 11136 Number of successful extensions: 39 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 39 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 39 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 47783067 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -