BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS312F03f (521 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBP35G2.10 |mit1||SHREC complex subunit Mit1|Schizosaccharomyce... 27 1.3 SPCC970.09 |sec8||exocyst complex subunit Sec8|Schizosaccharomyc... 25 6.8 SPCC622.11 |||LMBR1-like membrane protein|Schizosaccharomyces po... 25 9.0 >SPBP35G2.10 |mit1||SHREC complex subunit Mit1|Schizosaccharomyces pombe|chr 2|||Manual Length = 1418 Score = 27.5 bits (58), Expect = 1.3 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = +2 Query: 161 HIPAHCNVSYYPYTTHFTCHLSH 229 H+PAHC +S P F C H Sbjct: 1318 HLPAHCPLSIVPLEICFLCGTPH 1340 >SPCC970.09 |sec8||exocyst complex subunit Sec8|Schizosaccharomyces pombe|chr 3|||Manual Length = 1088 Score = 25.0 bits (52), Expect = 6.8 Identities = 9/25 (36%), Positives = 13/25 (52%) Frame = +1 Query: 16 IVYLHNNKQWTHLRWFPEMRRGERK 90 + YLHN+ +W R F G R+ Sbjct: 804 VSYLHNSMEWFLQRCFSRFMNGSRR 828 >SPCC622.11 |||LMBR1-like membrane protein|Schizosaccharomyces pombe|chr 3|||Manual Length = 562 Score = 24.6 bits (51), Expect = 9.0 Identities = 18/66 (27%), Positives = 31/66 (46%) Frame = +3 Query: 165 YLHIATYLTTLTQHILPVTCLISNI*DIFNTLLLASDVCMYVCNGIFEHHFDPLQNVGLT 344 +L I Y+T L I P CLI ++ LLL ++ I++ + +P + + Sbjct: 35 FLKIPVYMTHLGFPITPTVCLI----EMLGLLLLLLIPALFTLIWIYK-YIEPHSLISIP 89 Query: 345 RNFVYL 362 FV+L Sbjct: 90 GIFVFL 95 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,572,670 Number of Sequences: 5004 Number of extensions: 26350 Number of successful extensions: 77 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 77 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 77 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 212331630 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -