BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS312F03f (521 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF010315-1|AAC39533.1| 177|Homo sapiens Pig11 protein. 32 1.1 AY358192-1|AAQ88559.1| 118|Homo sapiens GLSH6409 protein. 31 2.4 >AF010315-1|AAC39533.1| 177|Homo sapiens Pig11 protein. Length = 177 Score = 32.3 bits (70), Expect = 1.1 Identities = 15/32 (46%), Positives = 17/32 (53%) Frame = -1 Query: 125 PAPHSTPTCCSALRSPRRISGNHRR*VHCLLL 30 P P P CC AL PR + +HR HCL L Sbjct: 127 PLPKELPPCCRALVWPRATTASHRH--HCLPL 156 >AY358192-1|AAQ88559.1| 118|Homo sapiens GLSH6409 protein. Length = 118 Score = 31.1 bits (67), Expect = 2.4 Identities = 14/34 (41%), Positives = 22/34 (64%) Frame = +1 Query: 142 LLFSLFPHTCTLQRILLPLHNTFYLSLVSSVTYR 243 L F +FP +C L + LP H+ F +SL+ S++ R Sbjct: 50 LTFPIFPISCDLFLLSLPPHHPFLVSLLLSLSLR 83 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 55,449,352 Number of Sequences: 237096 Number of extensions: 1003616 Number of successful extensions: 1997 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1963 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1997 length of database: 76,859,062 effective HSP length: 85 effective length of database: 56,705,902 effective search space used: 4990119376 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -