BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS312F02f (521 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY070617-1|AAL48088.1| 233|Drosophila melanogaster RE71995p pro... 73 2e-13 AE014297-421|AAF51900.1| 233|Drosophila melanogaster CG15592-PA... 73 2e-13 AE014297-420|AAF51901.1| 274|Drosophila melanogaster CG15591-PA... 50 2e-06 BT009951-1|AAQ22420.1| 295|Drosophila melanogaster RH51767p pro... 46 3e-05 AE014297-425|AAF51897.2| 295|Drosophila melanogaster CG1154-PA ... 46 3e-05 AY058538-1|AAL13767.1| 268|Drosophila melanogaster LD24139p pro... 40 0.002 AF231039-1|AAF34808.1| 268|Drosophila melanogaster SP558 protei... 40 0.002 AE014297-430|AAF51893.1| 268|Drosophila melanogaster CG1155-PA ... 40 0.002 AE014297-432|AAN13237.1| 278|Drosophila melanogaster CG31561-PA... 36 0.044 AE014297-424|AAF51898.1| 302|Drosophila melanogaster CG15596-PA... 32 0.41 AE014134-2062|AAF53094.1| 282|Drosophila melanogaster CG14925-P... 32 0.41 BT003530-1|AAO39534.1| 674|Drosophila melanogaster RE12147p pro... 29 3.8 AF132170-1|AAD34758.1| 286|Drosophila melanogaster unknown prot... 29 3.8 AE014298-1633|AAF48053.2| 784|Drosophila melanogaster CG32666-P... 29 3.8 AE014298-1632|AAS65317.1| 784|Drosophila melanogaster CG32666-P... 29 3.8 AE014297-418|AAF51903.2| 312|Drosophila melanogaster CG1151-PA ... 29 3.8 BT003287-1|AAO25045.1| 520|Drosophila melanogaster GM08204p pro... 29 5.1 AY069187-1|AAL39332.1| 465|Drosophila melanogaster GH23955p pro... 29 5.1 AE014297-905|AAN13414.1| 465|Drosophila melanogaster CG8866-PB,... 29 5.1 AE014297-904|AAF54358.1| 520|Drosophila melanogaster CG8866-PA,... 29 5.1 AY070982-1|AAL48604.1| 306|Drosophila melanogaster RE07882p pro... 28 6.7 AE014297-436|AAF51889.2| 306|Drosophila melanogaster CG1169-PA ... 28 6.7 AY058606-1|AAL13835.1| 543|Drosophila melanogaster LD29875p pro... 28 8.8 AE013599-2630|AAF57741.1| 543|Drosophila melanogaster CG5742-PA... 28 8.8 >AY070617-1|AAL48088.1| 233|Drosophila melanogaster RE71995p protein. Length = 233 Score = 72.9 bits (171), Expect = 2e-13 Identities = 37/114 (32%), Positives = 67/114 (58%), Gaps = 2/114 (1%) Frame = +2 Query: 80 EDVFRSVMGVLKTCSDDNVALCLKEKALRYVENVSNSRELNLIDGVSLIGQGSPRSARSF 259 + + S + ++K C + ++ LC+KE+AL Y + + + ++ L +G++L+ RS Sbjct: 22 DSLLTSALKMVKDCGERSMVLCMKERALHYFD--AENGDVRLTEGIALVKTDEIPVGRSL 79 Query: 260 EP--LPDEPRARENQVDLRLLDGVADFLENFVIQIRLPKGAIESAKRSLEEGRG 415 LP+E ARE +VD L++ VA F +Q ++PK +I+ +R+LEE RG Sbjct: 80 NEMQLPEEVEAREAEVDSLLVERVARFFGTHTLQFKVPKDSIQDMQRALEESRG 133 >AE014297-421|AAF51900.1| 233|Drosophila melanogaster CG15592-PA protein. Length = 233 Score = 72.9 bits (171), Expect = 2e-13 Identities = 37/114 (32%), Positives = 67/114 (58%), Gaps = 2/114 (1%) Frame = +2 Query: 80 EDVFRSVMGVLKTCSDDNVALCLKEKALRYVENVSNSRELNLIDGVSLIGQGSPRSARSF 259 + + S + ++K C + ++ LC+KE+AL Y + + + ++ L +G++L+ RS Sbjct: 22 DSLLTSALKMVKDCGERSMVLCMKERALHYFD--AENGDVRLTEGIALVKTDEIPVGRSL 79 Query: 260 EP--LPDEPRARENQVDLRLLDGVADFLENFVIQIRLPKGAIESAKRSLEEGRG 415 LP+E ARE +VD L++ VA F +Q ++PK +I+ +R+LEE RG Sbjct: 80 NEMQLPEEVEAREAEVDSLLVERVARFFGTHTLQFKVPKDSIQDMQRALEESRG 133 >AE014297-420|AAF51901.1| 274|Drosophila melanogaster CG15591-PA protein. Length = 274 Score = 50.0 bits (114), Expect = 2e-06 Identities = 33/118 (27%), Positives = 61/118 (51%), Gaps = 12/118 (10%) Frame = +2 Query: 98 VMGVLKTCSDDNVALCLKEKALRYVENVSNS-RELNLIDGVSLIGQG--------SPRSA 250 V + + CS DN+++CLK K L +E S + L+L++G+ + G +P S Sbjct: 61 VYRIYQQCSGDNMSVCLKVKLLTGLEKAFRSAKSLSLMEGIQFVSSGGESEETKRAPISE 120 Query: 251 RSFEP-LPDEPRARENQVDLRLLDGVADFLENFVIQIRLPKGA--IESAKRSLEEGRG 415 + E LP A+E ++ +L V +FL++ +Q++ A +E K+ ++G G Sbjct: 121 KDIEAVLPRSVDAKEQVLNNMILKRVGNFLQDHTLQVKFDNEANSVEGRKKKEKKGNG 178 >BT009951-1|AAQ22420.1| 295|Drosophila melanogaster RH51767p protein. Length = 295 Score = 46.0 bits (104), Expect = 3e-05 Identities = 29/116 (25%), Positives = 58/116 (50%), Gaps = 8/116 (6%) Frame = +2 Query: 92 RSVMGVLKTCSDDNVAL--CLKEKALRYVENVSNSRELNLIDGVSLIG-QGSPRSARSFE 262 R+++ V C+ CLK+KA+ +++ ++ +N+ +G+ L+ + +PR + E Sbjct: 46 RTLLRVYDECTRAEAGFVPCLKKKAISFIDRLAPIDAINVAEGIKLVRLETAPRPPATSE 105 Query: 263 -----PLPDEPRARENQVDLRLLDGVADFLENFVIQIRLPKGAIESAKRSLEEGRG 415 LP R+ ++ L++ ++ F +Q+ PK + R LEEGRG Sbjct: 106 NELESSLPRSGSDRDAKLTNMLIERLSYFFNGHSLQVSFPKLTSDEIGRGLEEGRG 161 >AE014297-425|AAF51897.2| 295|Drosophila melanogaster CG1154-PA protein. Length = 295 Score = 46.0 bits (104), Expect = 3e-05 Identities = 29/116 (25%), Positives = 58/116 (50%), Gaps = 8/116 (6%) Frame = +2 Query: 92 RSVMGVLKTCSDDNVAL--CLKEKALRYVENVSNSRELNLIDGVSLIG-QGSPRSARSFE 262 R+++ V C+ CLK+KA+ +++ ++ +N+ +G+ L+ + +PR + E Sbjct: 46 RTLLRVYDECTRAEAGFVPCLKKKAISFIDRLAPIDAINVAEGIKLVRLETAPRPPATSE 105 Query: 263 -----PLPDEPRARENQVDLRLLDGVADFLENFVIQIRLPKGAIESAKRSLEEGRG 415 LP R+ ++ L++ ++ F +Q+ PK + R LEEGRG Sbjct: 106 NELESSLPRSGSDRDAKLTNMLIERLSYFFNGHSLQVSFPKLTSDEIGRGLEEGRG 161 >AY058538-1|AAL13767.1| 268|Drosophila melanogaster LD24139p protein. Length = 268 Score = 39.9 bits (89), Expect = 0.002 Identities = 28/105 (26%), Positives = 47/105 (44%), Gaps = 9/105 (8%) Frame = +2 Query: 128 DNVALCLKEKALRYVENVSNSRELNLIDGVSLIGQ-GSP--RSARS------FEPLPDEP 280 D++A CL K + + + S + L GV+ SP R+ +S + LP Sbjct: 48 DDMATCLAVKGITALNRAARSNNIELASGVTFQRDPASPVSRTGKSMSEQDVYAELPQNA 107 Query: 281 RARENQVDLRLLDGVADFLENFVIQIRLPKGAIESAKRSLEEGRG 415 R ++ + ADFL ++ +LP + R+L+EGRG Sbjct: 108 DERTGRLVDLAVSSAADFLSTHNLEFKLPAETTQQVARALDEGRG 152 >AF231039-1|AAF34808.1| 268|Drosophila melanogaster SP558 protein protein. Length = 268 Score = 39.9 bits (89), Expect = 0.002 Identities = 28/105 (26%), Positives = 47/105 (44%), Gaps = 9/105 (8%) Frame = +2 Query: 128 DNVALCLKEKALRYVENVSNSRELNLIDGVSLIGQ-GSP--RSARS------FEPLPDEP 280 D++A CL K + + + S + L GV+ SP R+ +S + LP Sbjct: 48 DDMATCLAVKGITALNRAARSNNIELASGVTFQRDPASPVSRTGKSMSEQDVYAELPQNA 107 Query: 281 RARENQVDLRLLDGVADFLENFVIQIRLPKGAIESAKRSLEEGRG 415 R ++ + ADFL ++ +LP + R+L+EGRG Sbjct: 108 DERTRRLVDLAVSSAADFLSTHNLEFKLPAETTQQVARALDEGRG 152 >AE014297-430|AAF51893.1| 268|Drosophila melanogaster CG1155-PA protein. Length = 268 Score = 39.9 bits (89), Expect = 0.002 Identities = 28/105 (26%), Positives = 47/105 (44%), Gaps = 9/105 (8%) Frame = +2 Query: 128 DNVALCLKEKALRYVENVSNSRELNLIDGVSLIGQ-GSP--RSARS------FEPLPDEP 280 D++A CL K + + + S + L GV+ SP R+ +S + LP Sbjct: 48 DDMATCLAVKGITALNRAARSNNIELASGVTFQRDPASPVSRTGKSMSEQDVYAELPQNA 107 Query: 281 RARENQVDLRLLDGVADFLENFVIQIRLPKGAIESAKRSLEEGRG 415 R ++ + ADFL ++ +LP + R+L+EGRG Sbjct: 108 DERTGRLVDLAVSSAADFLSTHNLEFKLPAETTQQVARALDEGRG 152 >AE014297-432|AAN13237.1| 278|Drosophila melanogaster CG31561-PA protein. Length = 278 Score = 35.5 bits (78), Expect = 0.044 Identities = 23/91 (25%), Positives = 48/91 (52%) Frame = +2 Query: 140 LCLKEKALRYVENVSNSRELNLIDGVSLIGQGSPRSARSFEPLPDEPRARENQVDLRLLD 319 +CLK + ++ +E ++ ELN++ G+S++ + ++ E + + R+ + RL Sbjct: 62 MCLKIEFVKIMEKLAEQEELNVLPGISVVKDENATELKTSELMAEVARSYPSDPSTRLNG 121 Query: 320 GVADFLENFVIQIRLPKGAIESAKRSLEEGR 412 + LEN +++ R + + K SL EGR Sbjct: 122 YIVAKLEN-LLRTRFLRFRLLDDK-SLVEGR 150 >AE014297-424|AAF51898.1| 302|Drosophila melanogaster CG15596-PA protein. Length = 302 Score = 32.3 bits (70), Expect = 0.41 Identities = 27/111 (24%), Positives = 54/111 (48%), Gaps = 11/111 (9%) Frame = +2 Query: 71 NSDEDVFRSVMGVLKTCS-DDNVALCLKEKALRYVENVSNSRELNLIDGVSLIGQGS--- 238 +++ + R+V + C+ ++V C K + +R + +L ++DGVSL+ + S Sbjct: 31 STESGLLRTVRHIYGQCAYSEDVFWCCKIQGVRLLGRALKVPQLGIVDGVSLVRRESFTQ 90 Query: 239 -PRSARSFEPLPDEPRARE------NQVDLRLLDGVADFLENFVIQIRLPK 370 RS RS L + R+ +D LL+ +F+ + +Q+ LP+ Sbjct: 91 DTRSGRS-SLLESQLSNRDLEHLSGKSLDALLLERFLNFVHSHQLQVNLPR 140 >AE014134-2062|AAF53094.1| 282|Drosophila melanogaster CG14925-PA protein. Length = 282 Score = 32.3 bits (70), Expect = 0.41 Identities = 23/99 (23%), Positives = 41/99 (41%), Gaps = 2/99 (2%) Frame = +2 Query: 98 VMGVLKTCSDDNVAL-CLKEKALRYVENVSNSRELNLIDGVSLIGQGSPRSARSFEPLPD 274 V V C D N + CLK+KAL + + + ++DG++L Q + L D Sbjct: 54 VRRVYDDCQDKNDFIGCLKQKALHALSRALDQDSIKIVDGLALEKQNQSETESILGSLTD 113 Query: 275 EPR-ARENQVDLRLLDGVADFLENFVIQIRLPKGAIESA 388 + + +D LL + ++I + G E + Sbjct: 114 ARQFGNLSPIDRALLSKADKLMRTHTLKIDMDVGGGEDS 152 >BT003530-1|AAO39534.1| 674|Drosophila melanogaster RE12147p protein. Length = 674 Score = 29.1 bits (62), Expect = 3.8 Identities = 14/31 (45%), Positives = 16/31 (51%) Frame = -1 Query: 137 RRCHRSKFSALPSLIGRRLRHYSLRPQRILL 45 R C R AL L R + H L+PQ ILL Sbjct: 138 RHCMREVLKALKFLHDRSIAHLDLKPQNILL 168 >AF132170-1|AAD34758.1| 286|Drosophila melanogaster unknown protein. Length = 286 Score = 29.1 bits (62), Expect = 3.8 Identities = 13/53 (24%), Positives = 25/53 (47%) Frame = +2 Query: 104 GVLKTCSDDNVALCLKEKALRYVENVSNSRELNLIDGVSLIGQGSPRSARSFE 262 G C + + CL+ R ++V ++ ++ L GVSL+ R +S + Sbjct: 30 GAFAQCLESDSISCLQLTLFRKAKSVFDNPQIELFGGVSLVKSNEGRQGKSLD 82 >AE014298-1633|AAF48053.2| 784|Drosophila melanogaster CG32666-PB, isoform B protein. Length = 784 Score = 29.1 bits (62), Expect = 3.8 Identities = 14/31 (45%), Positives = 16/31 (51%) Frame = -1 Query: 137 RRCHRSKFSALPSLIGRRLRHYSLRPQRILL 45 R C R AL L R + H L+PQ ILL Sbjct: 138 RHCMREVLKALKFLHDRSIAHLDLKPQNILL 168 >AE014298-1632|AAS65317.1| 784|Drosophila melanogaster CG32666-PA, isoform A protein. Length = 784 Score = 29.1 bits (62), Expect = 3.8 Identities = 14/31 (45%), Positives = 16/31 (51%) Frame = -1 Query: 137 RRCHRSKFSALPSLIGRRLRHYSLRPQRILL 45 R C R AL L R + H L+PQ ILL Sbjct: 138 RHCMREVLKALKFLHDRSIAHLDLKPQNILL 168 >AE014297-418|AAF51903.2| 312|Drosophila melanogaster CG1151-PA protein. Length = 312 Score = 29.1 bits (62), Expect = 3.8 Identities = 13/53 (24%), Positives = 25/53 (47%) Frame = +2 Query: 104 GVLKTCSDDNVALCLKEKALRYVENVSNSRELNLIDGVSLIGQGSPRSARSFE 262 G C + + CL+ R ++V ++ ++ L GVSL+ R +S + Sbjct: 56 GAFAQCLESDSISCLQLTLFRKAKSVFDNPQIELFGGVSLVKSNEGRQGKSLD 108 >BT003287-1|AAO25045.1| 520|Drosophila melanogaster GM08204p protein. Length = 520 Score = 28.7 bits (61), Expect = 5.1 Identities = 16/49 (32%), Positives = 23/49 (46%) Frame = -1 Query: 188 NSRHFPRIAKLFP*DTMRRCHRSKFSALPSLIGRRLRHYSLRPQRILLT 42 N F R K P T R R +A+ + + H+ L+PQ +LLT Sbjct: 92 NLSAFIRTKKALPESTCRYFLRQLAAAVQYMRANDVSHFDLKPQNLLLT 140 >AY069187-1|AAL39332.1| 465|Drosophila melanogaster GH23955p protein. Length = 465 Score = 28.7 bits (61), Expect = 5.1 Identities = 16/49 (32%), Positives = 23/49 (46%) Frame = -1 Query: 188 NSRHFPRIAKLFP*DTMRRCHRSKFSALPSLIGRRLRHYSLRPQRILLT 42 N F R K P T R R +A+ + + H+ L+PQ +LLT Sbjct: 92 NLSAFIRTKKALPESTCRYFLRQLAAAVQYMRANDVSHFDLKPQNLLLT 140 >AE014297-905|AAN13414.1| 465|Drosophila melanogaster CG8866-PB, isoform B protein. Length = 465 Score = 28.7 bits (61), Expect = 5.1 Identities = 16/49 (32%), Positives = 23/49 (46%) Frame = -1 Query: 188 NSRHFPRIAKLFP*DTMRRCHRSKFSALPSLIGRRLRHYSLRPQRILLT 42 N F R K P T R R +A+ + + H+ L+PQ +LLT Sbjct: 92 NLSAFIRTKKALPESTCRYFLRQLAAAVQYMRANDVSHFDLKPQNLLLT 140 >AE014297-904|AAF54358.1| 520|Drosophila melanogaster CG8866-PA, isoform A protein. Length = 520 Score = 28.7 bits (61), Expect = 5.1 Identities = 16/49 (32%), Positives = 23/49 (46%) Frame = -1 Query: 188 NSRHFPRIAKLFP*DTMRRCHRSKFSALPSLIGRRLRHYSLRPQRILLT 42 N F R K P T R R +A+ + + H+ L+PQ +LLT Sbjct: 92 NLSAFIRTKKALPESTCRYFLRQLAAAVQYMRANDVSHFDLKPQNLLLT 140 >AY070982-1|AAL48604.1| 306|Drosophila melanogaster RE07882p protein. Length = 306 Score = 28.3 bits (60), Expect = 6.7 Identities = 21/94 (22%), Positives = 41/94 (43%) Frame = +2 Query: 119 CSDDNVALCLKEKALRYVENVSNSRELNLIDGVSLIGQGSPRSARSFEPLPDEPRARENQ 298 C D C++ KAL++ + E+ + + +S++ +RS P Sbjct: 43 CLKDLSVSCVRPKALQWFNSALRQPEVRITERLSIVRTAEKVESRSMNP----------- 91 Query: 299 VDLRLLDGVADFLENFVIQIRLPKGAIESAKRSL 400 + RL D + +L + ++I+ P+ S RSL Sbjct: 92 -EERLFDDIDSYLGSHSLRIQAPEYFRTSEARSL 124 >AE014297-436|AAF51889.2| 306|Drosophila melanogaster CG1169-PA protein. Length = 306 Score = 28.3 bits (60), Expect = 6.7 Identities = 21/94 (22%), Positives = 41/94 (43%) Frame = +2 Query: 119 CSDDNVALCLKEKALRYVENVSNSRELNLIDGVSLIGQGSPRSARSFEPLPDEPRARENQ 298 C D C++ KAL++ + E+ + + +S++ +RS P Sbjct: 43 CLKDLSVSCVRPKALQWFNSALRQPEVRITERLSIVRTAEKVESRSMNP----------- 91 Query: 299 VDLRLLDGVADFLENFVIQIRLPKGAIESAKRSL 400 + RL D + +L + ++I+ P+ S RSL Sbjct: 92 -EERLFDDIDSYLGSHSLRIQAPEYFRTSEARSL 124 >AY058606-1|AAL13835.1| 543|Drosophila melanogaster LD29875p protein. Length = 543 Score = 27.9 bits (59), Expect = 8.8 Identities = 14/36 (38%), Positives = 17/36 (47%) Frame = +1 Query: 403 RRSR*EEEVEATPAHTGTPATEDPVPHPRLPRNHCL 510 RRS + ATP T TP + + P LPR L Sbjct: 378 RRSSLGSQHTATPPETNTPTAPNGISLPELPRRSSL 413 >AE013599-2630|AAF57741.1| 543|Drosophila melanogaster CG5742-PA protein. Length = 543 Score = 27.9 bits (59), Expect = 8.8 Identities = 14/36 (38%), Positives = 17/36 (47%) Frame = +1 Query: 403 RRSR*EEEVEATPAHTGTPATEDPVPHPRLPRNHCL 510 RRS + ATP T TP + + P LPR L Sbjct: 378 RRSSLGSQHTATPPETNTPTAPNGISLPELPRRSSL 413 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,889,039 Number of Sequences: 53049 Number of extensions: 463581 Number of successful extensions: 1627 Number of sequences better than 10.0: 24 Number of HSP's better than 10.0 without gapping: 1574 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1625 length of database: 24,988,368 effective HSP length: 80 effective length of database: 20,744,448 effective search space used: 1929233664 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -