BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS312E04f (521 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB022907-1|BAA86908.1| 615|Apis mellifera glucose oxidase protein. 29 0.038 AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamat... 23 1.4 AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamat... 23 1.4 AF213011-1|AAG43567.1| 62|Apis mellifera esterase A2 protein. 23 1.9 DQ667182-1|ABG75734.1| 445|Apis mellifera GABA-gated chloride c... 23 2.5 DQ667181-1|ABG75733.1| 445|Apis mellifera GABA-gated chloride c... 23 2.5 AF094822-1|AAC63381.1| 365|Apis mellifera GABA receptor Rdl sub... 23 2.5 AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein ... 22 4.4 >AB022907-1|BAA86908.1| 615|Apis mellifera glucose oxidase protein. Length = 615 Score = 28.7 bits (61), Expect = 0.038 Identities = 16/55 (29%), Positives = 26/55 (47%) Frame = +1 Query: 142 PVLWSNRLYTPEHRLNLHINLVTAESEIATNNVPHKLEIEYGSTPGQKLDIFGTD 306 PV+WSN L T EH ++ I + ++ V L +E+ ++ D F D Sbjct: 473 PVIWSNDLAT-EHDRSVMIQAIRVVQKLVNTTVMRDLGVEFQKIELKQCDEFVED 526 >AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamate receptor 1 protein. Length = 843 Score = 23.4 bits (48), Expect = 1.4 Identities = 11/16 (68%), Positives = 12/16 (75%) Frame = -1 Query: 239 TLFVAISLSAVTRLMC 192 TL VAISLSA L+C Sbjct: 739 TLCVAISLSATVTLVC 754 >AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamate receptor protein. Length = 933 Score = 23.4 bits (48), Expect = 1.4 Identities = 11/16 (68%), Positives = 12/16 (75%) Frame = -1 Query: 239 TLFVAISLSAVTRLMC 192 TL VAISLSA L+C Sbjct: 829 TLCVAISLSATVTLVC 844 >AF213011-1|AAG43567.1| 62|Apis mellifera esterase A2 protein. Length = 62 Score = 23.0 bits (47), Expect = 1.9 Identities = 10/50 (20%), Positives = 19/50 (38%) Frame = +1 Query: 286 LDIFGTDLPNESPILVFIHGGYWPDVSREISRYPAKSLYPAGVKTIIVGY 435 LD++ L P++ ++H G + + L P V + Y Sbjct: 7 LDVYTNSLDQSKPVMFYVHEGAFISGTSSFHEMRPDYLLPKDVVVVSSNY 56 >DQ667182-1|ABG75734.1| 445|Apis mellifera GABA-gated chloride channel protein. Length = 445 Score = 22.6 bits (46), Expect = 2.5 Identities = 10/28 (35%), Positives = 15/28 (53%) Frame = -3 Query: 153 PQHRCVFSFQIHKFHGDRPLYLSKYSKV 70 PQH I+K +G P + KYS++ Sbjct: 383 PQHLIHPGKDINKLYGMTPSDIDKYSRI 410 >DQ667181-1|ABG75733.1| 445|Apis mellifera GABA-gated chloride channel protein. Length = 445 Score = 22.6 bits (46), Expect = 2.5 Identities = 10/28 (35%), Positives = 15/28 (53%) Frame = -3 Query: 153 PQHRCVFSFQIHKFHGDRPLYLSKYSKV 70 PQH I+K +G P + KYS++ Sbjct: 383 PQHLIHPGKDINKLYGMTPSDIDKYSRI 410 >AF094822-1|AAC63381.1| 365|Apis mellifera GABA receptor Rdl subunit protein. Length = 365 Score = 22.6 bits (46), Expect = 2.5 Identities = 10/28 (35%), Positives = 15/28 (53%) Frame = -3 Query: 153 PQHRCVFSFQIHKFHGDRPLYLSKYSKV 70 PQH I+K +G P + KYS++ Sbjct: 321 PQHLIHPGKDINKLYGMTPSDIDKYSRI 348 >AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein 1 protein. Length = 500 Score = 21.8 bits (44), Expect = 4.4 Identities = 8/24 (33%), Positives = 13/24 (54%) Frame = -2 Query: 331 RELEIHSGGRYRKCPASVRALIRT 260 R + IH+G R KC + I++ Sbjct: 165 RHMRIHTGERPHKCTVCSKTFIQS 188 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 164,398 Number of Sequences: 438 Number of extensions: 3750 Number of successful extensions: 10 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14600229 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -