BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS312E03f (521 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY496420-1|AAS80137.1| 447|Anopheles gambiae bacteria responsiv... 26 0.67 DQ655702-1|ABG45862.1| 889|Anopheles gambiae Jxc1 protein. 25 1.2 M93691-2|AAA29365.1| 1222|Anopheles gambiae protein ( Anopheles ... 23 6.2 M93689-2|AAA29367.1| 975|Anopheles gambiae protein ( Anopheles ... 23 6.2 AB090813-2|BAC57902.1| 1099|Anopheles gambiae reverse transcript... 23 6.2 >AY496420-1|AAS80137.1| 447|Anopheles gambiae bacteria responsive protein 1 protein. Length = 447 Score = 26.2 bits (55), Expect = 0.67 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = -1 Query: 122 LAGDIGAQSAQTSPPGGPSAGGVITSKPG 36 L GD G P GPS G T+ PG Sbjct: 313 LVGDSGITGVPPIPADGPSPAGPYTNVPG 341 >DQ655702-1|ABG45862.1| 889|Anopheles gambiae Jxc1 protein. Length = 889 Score = 25.4 bits (53), Expect = 1.2 Identities = 15/41 (36%), Positives = 21/41 (51%), Gaps = 3/41 (7%) Frame = +1 Query: 52 ITPPALGPPGGDVWADCAPISPARRKYLLSFQGL---QPPP 165 I P L PP + A P++PA+ ++ F L QPPP Sbjct: 543 IPPQFLPPPLNLLRAPFFPLNPAQLRFPAGFPNLPNAQPPP 583 >M93691-2|AAA29365.1| 1222|Anopheles gambiae protein ( Anopheles gambiae RT2 retroposon. ). Length = 1222 Score = 23.0 bits (47), Expect = 6.2 Identities = 12/32 (37%), Positives = 15/32 (46%) Frame = -3 Query: 150 TLKTEQVLSSCGRYRRTICPNITTRRA*CRWC 55 T QVLS G +R +C N T C+ C Sbjct: 976 TFHLAQVLSGHGFFRDYLCHNGFTSSPDCQLC 1007 >M93689-2|AAA29367.1| 975|Anopheles gambiae protein ( Anopheles gambiae T1 retroposon. ). Length = 975 Score = 23.0 bits (47), Expect = 6.2 Identities = 15/41 (36%), Positives = 18/41 (43%) Frame = -2 Query: 262 RTAEKKHQTLVLFSPFFLAMISTFHLDPCLIL*AVVVNPEN 140 RTA + LFS F M DP LI ++ PEN Sbjct: 421 RTASTPVEICELFSAHFSQMFEPPVSDPNLIEGGLLYTPEN 461 >AB090813-2|BAC57902.1| 1099|Anopheles gambiae reverse transcriptase protein. Length = 1099 Score = 23.0 bits (47), Expect = 6.2 Identities = 12/41 (29%), Positives = 20/41 (48%) Frame = -3 Query: 135 QVLSSCGRYRRTICPNITTRRA*CRWCDYIKTWSKMIVRKC 13 QVLS G +R +C N T C+ C + ++ + +C Sbjct: 918 QVLSGHGFFRDYLCRNGFTSSPDCQRCSGVPETAEHAMFEC 958 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 602,528 Number of Sequences: 2352 Number of extensions: 12624 Number of successful extensions: 24 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 24 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 24 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 47783067 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -