BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS312E03f (521 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related pro... 23 1.4 AY217747-1|AAP45005.1| 246|Apis mellifera short-chain dehydroge... 21 5.8 AY155490-1|AAO12861.1| 342|Apis mellifera Ammar1 transposase pr... 21 5.8 AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate r... 21 7.7 >DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related protein STG-1 protein. Length = 397 Score = 23.4 bits (48), Expect = 1.4 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -1 Query: 80 PGGPSAGGVITSKPG 36 PG SAGGV+T G Sbjct: 22 PGSSSAGGVVTGASG 36 >AY217747-1|AAP45005.1| 246|Apis mellifera short-chain dehydrogenase/reductase protein. Length = 246 Score = 21.4 bits (43), Expect = 5.8 Identities = 11/28 (39%), Positives = 16/28 (57%), Gaps = 4/28 (14%) Frame = +1 Query: 448 GAIPVVLGGDRIR----LPYEEVLDWKR 519 GAI +++ I L +EVLDWK+ Sbjct: 83 GAIDILINNATINIDVTLQNDEVLDWKK 110 >AY155490-1|AAO12861.1| 342|Apis mellifera Ammar1 transposase protein. Length = 342 Score = 21.4 bits (43), Expect = 5.8 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = +1 Query: 304 GDWALCGTDRSRRAVLRDSTFVLILAPADRNYVTTALLQ 420 GD++L RS R V D + + +DR+ T + + Sbjct: 53 GDFSLKDEKRSGRPVEVDDDLIKAIIDSDRHSTTREIAE 91 >AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate receptor 1 protein. Length = 953 Score = 21.0 bits (42), Expect = 7.7 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = +3 Query: 279 GETRNFADRRLGALWNG 329 G R+F+ R LG +W G Sbjct: 629 GTPRSFSARVLGMVWAG 645 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 159,986 Number of Sequences: 438 Number of extensions: 3611 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14600229 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -