BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS312E01f (521 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPMIT.01 |cox1||cytochrome c oxidase 1|Schizosaccharomyces pombe... 91 1e-19 SPAC30D11.06c |||DUF300 family protein|Schizosaccharomyces pombe... 25 5.2 >SPMIT.01 |cox1||cytochrome c oxidase 1|Schizosaccharomyces pombe|chr mitochondrial|||Manual Length = 537 Score = 90.6 bits (215), Expect = 1e-19 Identities = 45/85 (52%), Positives = 52/85 (61%) Frame = +1 Query: 1 SSIDITLHDTYYVVAHFHYVLSXXXXXXXXXXXXN*YPLFTGLSLNSYILKIQFFTIFIG 180 S +DI HDTY+VVAHFHYVLS P GL N + IQF+ +FIG Sbjct: 368 SVLDIAFHDTYFVVAHFHYVLSMGALFGLCGAYYW-SPKMFGLMYNETLASIQFWILFIG 426 Query: 181 VNITFFPQHFLGLAGIPRRYSDYPD 255 VNI F PQHFLGL G+PRR DYP+ Sbjct: 427 VNIVFGPQHFLGLNGMPRRIPDYPE 451 >SPAC30D11.06c |||DUF300 family protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 426 Score = 25.4 bits (53), Expect = 5.2 Identities = 15/43 (34%), Positives = 21/43 (48%) Frame = +3 Query: 120 YRPFIKFLYTKNSIFYNIYWSKYNIFSTTFFRFSWNTSTIFRL 248 +RPF KFL K IF + YW + + T + T I+ L Sbjct: 201 FRPFPKFLSVKAIIFAS-YWQQTVLSITNWLGLLNGTGWIYSL 242 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,581,900 Number of Sequences: 5004 Number of extensions: 27028 Number of successful extensions: 71 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 69 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 70 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 212331630 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -