BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS312E01f (521 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_01_0496 + 3939731-3939758,3940459-3942773 27 9.1 >12_01_0496 + 3939731-3939758,3940459-3942773 Length = 780 Score = 27.1 bits (57), Expect = 9.1 Identities = 19/57 (33%), Positives = 26/57 (45%) Frame = +3 Query: 99 Y*LISFIYRPFIKFLYTKNSIFYNIYWSKYNIFSTTFFRFSWNTSTIFRLSRLIYFM 269 Y + F R + Y IF N+YW + S T +R S+N S L +L FM Sbjct: 164 YYTLRFDDRYVLSLAYDGPDIF-NLYWPNPDQSSWTNYRISYNRSRSGVLDKLGKFM 219 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,037,742 Number of Sequences: 37544 Number of extensions: 132599 Number of successful extensions: 235 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 227 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 235 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1142636160 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -