BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS312D07f (521 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_01_0067 - 673381-673387,675388-678131 28 4.0 12_02_0518 - 19937507-19938481,19938805-19939151,19939246-19939387 28 5.2 03_02_0692 - 10438088-10438123,10438247-10438317,10438551-104386... 27 9.1 >04_01_0067 - 673381-673387,675388-678131 Length = 916 Score = 28.3 bits (60), Expect = 4.0 Identities = 11/30 (36%), Positives = 21/30 (70%) Frame = +3 Query: 123 LRTLLLLASYIFLFRCIFERHFRQPQDVKI 212 LRTL++L S+IF C + FR+ +++++ Sbjct: 565 LRTLIVLRSFIFSSSCFQDEFFRKIRNLRV 594 >12_02_0518 - 19937507-19938481,19938805-19939151,19939246-19939387 Length = 487 Score = 27.9 bits (59), Expect = 5.2 Identities = 13/50 (26%), Positives = 26/50 (52%) Frame = +3 Query: 60 GVINMYLITFLC*FH*TGSDFLRTLLLLASYIFLFRCIFERHFRQPQDVK 209 GV+ M I+ G+ +L + AS++F++ C+ E R +D++ Sbjct: 432 GVVTMTFISLYGAITMAGAFYLYAAIAAASFVFIYACLPETRGRSLEDME 481 >03_02_0692 - 10438088-10438123,10438247-10438317,10438551-10438620, 10439551-10439919 Length = 181 Score = 27.1 bits (57), Expect = 9.1 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = +2 Query: 296 YGLGFGINKNSTEVQIKTVLALRTLTEDFKILN 394 Y G+G+NKN + QI T A R + +K+ N Sbjct: 111 YRSGYGVNKNEHKAQIWTEKASRYRSTVWKVSN 143 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,247,845 Number of Sequences: 37544 Number of extensions: 210927 Number of successful extensions: 379 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 374 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 379 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1142636160 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -