BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS312D05f (521 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC21C3.16c |spt4||transcription elongation factor complex subu... 29 0.32 SPCC1682.08c |||RNA-binding protein Mcp2|Schizosaccharomyces pom... 27 1.3 SPBC1685.10 |rps27||40S ribosomal protein S27|Schizosaccharomyce... 26 3.0 SPAC167.05 ||SPAC57A7.01|Usp |Schizosaccharomyces pombe|chr 1|||... 25 6.8 SPCC18.01c |adg3|SPCC74.07c|beta-glucosidase Adg3 |Schizosacchar... 25 6.8 SPAC27E2.07 |pvg2|mug53|galactose residue biosynthesis protein P... 25 9.0 SPAC4F10.09c |||ribosome biogenesis protein Noc1 |Schizosaccharo... 25 9.0 >SPBC21C3.16c |spt4||transcription elongation factor complex subunit Spt4|Schizosaccharomyces pombe|chr 2|||Manual Length = 105 Score = 29.5 bits (63), Expect = 0.32 Identities = 13/36 (36%), Positives = 18/36 (50%) Frame = -3 Query: 294 RLVERQSTRCHCCNWHVPHSCLSRWGCNIDGVSTIE 187 +L +S C C +PHS + GC DGV +E Sbjct: 3 KLNRTRSRACLICGIVLPHSVFANKGCPNDGVDDVE 38 >SPCC1682.08c |||RNA-binding protein Mcp2|Schizosaccharomyces pombe|chr 3|||Manual Length = 703 Score = 27.5 bits (58), Expect = 1.3 Identities = 12/33 (36%), Positives = 20/33 (60%) Frame = +1 Query: 382 FSNRSYEYPLSRSWHVVMQDESTQRGNWHELAI 480 F + YEYP++ V+ + + RG WHE+A+ Sbjct: 491 FETQWYEYPVN----VMNRVNNALRGKWHEVAV 519 >SPBC1685.10 |rps27||40S ribosomal protein S27|Schizosaccharomyces pombe|chr 2|||Manual Length = 83 Score = 26.2 bits (55), Expect = 3.0 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = +1 Query: 205 VDIASPSGEARMRDMPIATMAPGALSFYQPLK 300 VD+ +PS E+ MR + + G SF+ +K Sbjct: 5 VDLLNPSHESEMRKHKLKQLVQGPRSFFMDVK 36 >SPAC167.05 ||SPAC57A7.01|Usp |Schizosaccharomyces pombe|chr 1|||Manual Length = 601 Score = 25.0 bits (52), Expect = 6.8 Identities = 14/40 (35%), Positives = 20/40 (50%) Frame = +2 Query: 305 MNSLPITSLATNINPTVLSMAQGYIPSVIAATNIPYLDPG 424 M+S +TSL + NP + QG PS I N+ + G Sbjct: 65 MDSSLMTSLPHSRNPPIFEAIQGEQPSDIDTLNLKKVKSG 104 >SPCC18.01c |adg3|SPCC74.07c|beta-glucosidase Adg3 |Schizosaccharomyces pombe|chr 3|||Manual Length = 1131 Score = 25.0 bits (52), Expect = 6.8 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = +1 Query: 349 YCSIDGTRIHTFSNRSYEYP 408 YC+ DG + F ++ Y YP Sbjct: 138 YCNSDGVAVKPFPSKDYCYP 157 >SPAC27E2.07 |pvg2|mug53|galactose residue biosynthesis protein Pvg2|Schizosaccharomyces pombe|chr 1|||Manual Length = 389 Score = 24.6 bits (51), Expect = 9.0 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = +3 Query: 333 PPISTLLFYRWHKDT 377 PPIS LFY +++DT Sbjct: 94 PPISAHLFYTYNRDT 108 >SPAC4F10.09c |||ribosome biogenesis protein Noc1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 860 Score = 24.6 bits (51), Expect = 9.0 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = +3 Query: 336 PISTLLFYRWHKDTYLQ*SQLR 401 P+ L FYR+ D Y++ Q R Sbjct: 688 PVDELFFYRFFNDKYIKGKQAR 709 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,328,482 Number of Sequences: 5004 Number of extensions: 49595 Number of successful extensions: 130 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 127 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 130 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 212331630 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -