BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS312D05f (521 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g12710.1 68414.m01474 F-box family protein / SKP1 interacting... 27 5.8 At2g33260.1 68415.m04077 tryptophan/tyrosine permease family pro... 27 7.7 >At1g12710.1 68414.m01474 F-box family protein / SKP1 interacting partner 3-related contains Pfam profile PF00646: F-box domain Length = 291 Score = 27.5 bits (58), Expect = 5.8 Identities = 17/45 (37%), Positives = 20/45 (44%), Gaps = 1/45 (2%) Frame = +2 Query: 353 VLSMAQGYIPSVIAATNIPYLDPGT*SCRTSLLNAA-TGTSWLSC 484 +L G +P A + LDP CR S LN A G SW C Sbjct: 23 ILKPGLGDLPEACVAIIVENLDPVE-ICRFSKLNRAFRGASWADC 66 >At2g33260.1 68415.m04077 tryptophan/tyrosine permease family protein contains Pfam profile PF03222: Tryptophan/tyrosine permease family Length = 436 Score = 27.1 bits (57), Expect = 7.7 Identities = 12/29 (41%), Positives = 18/29 (62%) Frame = +2 Query: 326 SLATNINPTVLSMAQGYIPSVIAATNIPY 412 SL ++NP+ LS QG+ S +A + I Y Sbjct: 271 SLLLSVNPSALSAVQGFAFSALATSLIGY 299 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,163,279 Number of Sequences: 28952 Number of extensions: 256679 Number of successful extensions: 667 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 650 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 667 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 957410176 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -