BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS312C12f (521 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g26430.1 68417.m03803 COP9 signalosome subunit 6 / CSN subuni... 27 5.8 At4g02740.1 68417.m00374 F-box family protein contains Pfam PF00... 27 7.7 >At4g26430.1 68417.m03803 COP9 signalosome subunit 6 / CSN subunit 6 (CSN6B) identical to COP9 signalosome subunit 6 [Arabidopsis thaliana] GI:17940314, CSN complex subunit 6B [Arabidopsis thaliana] GI:18056667; contains Pfam profile PF01398: Mov34/MPN/PAD-1 family; supporting cDNA gi|17940313|gb|AF434762.1|AF434762; identical to cDNA CSN complex subunit 6B (CSN6B) GI:18056666 Length = 317 Score = 27.5 bits (58), Expect = 5.8 Identities = 16/49 (32%), Positives = 23/49 (46%), Gaps = 2/49 (4%) Frame = -3 Query: 381 ISSIHIQPHYILQNPXSSCVTQSNRQYFYFLQFY--DGISQRIFAQTQY 241 + I+ P Y+L NP + + Y +F+ DGI Q IF T Y Sbjct: 130 LMDINESPVYVLLNPAINHAQKDLPVTIYESEFHVIDGIPQSIFVHTSY 178 >At4g02740.1 68417.m00374 F-box family protein contains Pfam PF00646: F-box domain; similar to F-box protein FBL2 (GI:6063090) [Homo sapiens] Length = 645 Score = 27.1 bits (57), Expect = 7.7 Identities = 12/30 (40%), Positives = 21/30 (70%) Frame = -2 Query: 121 RLRYLNRSLVSLQDNVKGRFVSKLFYNTVS 32 +L+YLN +S +KGRF+ K ++N+V+ Sbjct: 275 KLKYLN---LSRSPTIKGRFLRKKYWNSVT 301 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,812,544 Number of Sequences: 28952 Number of extensions: 176979 Number of successful extensions: 400 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 394 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 400 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 957410176 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -