BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS312C11f (521 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC8E11.02c |rad24||14-3-3 protein Rad24|Schizosaccharomyces po... 182 4e-47 SPAC17A2.13c |rad25||14-3-3 protein Rad25|Schizosaccharomyces po... 180 9e-47 SPBC16C6.02c |vps1302|vps13b|chorein homolog|Schizosaccharomyces... 33 0.020 SPBC15C4.04c |||amino acid permease, unknown 10|Schizosaccharomy... 31 0.079 SPCC188.11 |prp45|cwf13, snw1, SPCC584.08|transcriptional regula... 29 0.32 SPAC1486.05 |nup189||nucleoporin Nup189|Schizosaccharomyces pomb... 27 1.7 SPBC16H5.05c |cyp7|cwf27|cyclophilin family peptidyl-prolyl cis-... 27 2.2 SPBC839.10 |usp107|snu71|U1 snRNP-associated protein Usp107|Schi... 27 2.2 SPBC3E7.11c |||DNAJ protein Caj1/Djp1-type|Schizosaccharomyces p... 27 2.2 SPAC323.04 |||mitochondrial ATPase |Schizosaccharomyces pombe|ch... 26 3.9 SPAC1006.04c |mcp3|mug7|sequence orphan|Schizosaccharomyces pomb... 25 5.2 SPAC1420.01c ||SPAC56E4.08c|DUF1752 family protein|Schizosacchar... 25 5.2 SPBC6B1.04 |mde4||monopolin-like complex subunit Mde4|Schizosacc... 25 5.2 SPAC3A11.05c |kms1||meiotic spindle pole body protein Kms1|Schiz... 25 6.8 SPBC14F5.03c |kap123||karyopherin Kap123|Schizosaccharomyces pom... 25 6.8 SPAC19B12.03 |bgs3||1,3-beta-glucan synthase subunit Bgs3|Schizo... 25 6.8 SPAC589.12 ||SPAC688.01|glycosylceramide biosynthesis protein |S... 25 6.8 SPAC3G6.11 |||ATP-dependent DNA helicase Chl1|Schizosaccharomyce... 25 9.0 SPBC11C11.07 |rpl1801|rpl18-1, rpl18|60S ribosomal protein L18|S... 25 9.0 >SPAC8E11.02c |rad24||14-3-3 protein Rad24|Schizosaccharomyces pombe|chr 1|||Manual Length = 270 Score = 182 bits (442), Expect = 4e-47 Identities = 89/148 (60%), Positives = 110/148 (74%), Gaps = 2/148 (1%) Frame = +3 Query: 81 SVDKEELVQRAKLAEQAERYDDMAAAMKEVTETGVELSNEERNLLSVAYKNVVGARRSSW 260 + +E+ V AKLAEQAERY+ M MK V T EL+ EERNLLSVAYKNV+GARR+SW Sbjct: 3 TTSREDAVYLAKLAEQAERYEGMVENMKSVASTDQELTVEERNLLSVAYKNVIGARRASW 62 Query: 261 RVISSIEQKTE--GSERKQQMAKEYRVKVEKELREICYDVLGLLDKHLIPKASNPESKVF 434 R++SSIEQK E G+ + ++ KEYR K+E+EL IC D+L +L+KHLIP A++ ESKVF Sbjct: 63 RIVSSIEQKEESKGNTAQVELIKEYRQKIEQELDTICQDILTVLEKHLIPNAASAESKVF 122 Query: 435 YLKMKGDYYRYLAEVATGETRHSVVEDS 518 Y KMKGDYYRYLAE A GE R + S Sbjct: 123 YYKMKGDYYRYLAEFAVGEKRQHSADQS 150 >SPAC17A2.13c |rad25||14-3-3 protein Rad25|Schizosaccharomyces pombe|chr 1|||Manual Length = 270 Score = 180 bits (439), Expect = 9e-47 Identities = 90/149 (60%), Positives = 110/149 (73%), Gaps = 2/149 (1%) Frame = +3 Query: 78 MSVDKEELVQRAKLAEQAERYDDMAAAMKEVTETGVELSNEERNLLSVAYKNVVGARRSS 257 MS +E V AKLAEQAERY++M MK+V + +LS EERNLLSVAYKN++GARR+S Sbjct: 1 MSNSRENSVYLAKLAEQAERYEEMVENMKKVACSNDKLSVEERNLLSVAYKNIIGARRAS 60 Query: 258 WRVISSIEQKTE--GSERKQQMAKEYRVKVEKELREICYDVLGLLDKHLIPKASNPESKV 431 WR+ISSIEQK E G+ R+ + KEYR K+E EL +IC+DVL +L+KHLIP A+ ESKV Sbjct: 61 WRIISSIEQKEESRGNTRQAALIKEYRKKIEDELSDICHDVLSVLEKHLIPAATTGESKV 120 Query: 432 FYLKMKGDYYRYLAEVATGETRHSVVEDS 518 FY KMKGDYYRYLAE GE + S Sbjct: 121 FYYKMKGDYYRYLAEFTVGEVCKEAADSS 149 >SPBC16C6.02c |vps1302|vps13b|chorein homolog|Schizosaccharomyces pombe|chr 2|||Manual Length = 3131 Score = 33.5 bits (73), Expect = 0.020 Identities = 25/104 (24%), Positives = 44/104 (42%) Frame = +3 Query: 54 ISSLPSSTMSVDKEELVQRAKLAEQAERYDDMAAAMKEVTETGVELSNEERNLLSVAYKN 233 I S+ S S EEL+ R + + Y+ MA + E E ++ + LLS Y N Sbjct: 2998 IMSITMSDSSAYGEELM-RERFEHLLKAYEKMALMVAEQEEFNAKIEDMALKLLSEKYDN 3056 Query: 234 VVGARRSSWRVISSIEQKTEGSERKQQMAKEYRVKVEKELREIC 365 +R+ + +E+ + EY +E+ L++ C Sbjct: 3057 EAYQAELFYRLSNCVEKVLHNKISITDLKTEYEEILEQTLKKEC 3100 >SPBC15C4.04c |||amino acid permease, unknown 10|Schizosaccharomyces pombe|chr 2|||Manual Length = 542 Score = 31.5 bits (68), Expect = 0.079 Identities = 21/67 (31%), Positives = 36/67 (53%), Gaps = 3/67 (4%) Frame = +3 Query: 81 SVDKEELVQRAKLAEQAERYDDMAAAMKEVT--ETGVELSNEERN-LLSVAYKNVVGARR 251 SV + ++ K ++ E + ++ + +K V+ ET E+SN+E N LL + YK V Sbjct: 3 SVSNVSVNEQGKFNDKEEGFSNLKS-LKHVSHSETDFEVSNDEDNQLLELGYKPVFKREF 61 Query: 252 SSWRVIS 272 S+W S Sbjct: 62 STWATFS 68 >SPCC188.11 |prp45|cwf13, snw1, SPCC584.08|transcriptional regulator Prp45|Schizosaccharomyces pombe|chr 3|||Manual Length = 557 Score = 29.5 bits (63), Expect = 0.32 Identities = 27/93 (29%), Positives = 45/93 (48%), Gaps = 3/93 (3%) Frame = +3 Query: 87 DKEELVQRAKLAEQAERYDDMAAAMKEVTETGVELSNEERNLLSVAYKNVVGARRSSWRV 266 +K+E QR + Q R D M + +G S+ + SV+ + +R S+ Sbjct: 320 EKQEKEQRLFMLAQKAREDRMG---RNAASSGP--SHAKPRSTSVSSEERSRSRAGSFSH 374 Query: 267 ISSIEQKTEGSE---RKQQMAKEYRVKVEKELR 356 S E + E SE R+Q++ +E R + EK+LR Sbjct: 375 HSESENEDEDSEAFRRRQELRRERRRQAEKDLR 407 >SPAC1486.05 |nup189||nucleoporin Nup189|Schizosaccharomyces pombe|chr 1|||Manual Length = 1778 Score = 27.1 bits (57), Expect = 1.7 Identities = 15/49 (30%), Positives = 26/49 (53%), Gaps = 3/49 (6%) Frame = +3 Query: 381 LLDKHLIPKASNPESKVFYLKMKGDYYR---YLAEVATGETRHSVVEDS 518 +++K IP++ E+K Y + GD+ +L E A E H V+ D+ Sbjct: 1608 MIEKLCIPESWLNEAKALYARYVGDHLNELYFLQEAALYEDAHKVLLDT 1656 >SPBC16H5.05c |cyp7|cwf27|cyclophilin family peptidyl-prolyl cis-trans isomerase Cyp7|Schizosaccharomyces pombe|chr 2|||Manual Length = 463 Score = 26.6 bits (56), Expect = 2.2 Identities = 12/39 (30%), Positives = 20/39 (51%) Frame = +3 Query: 228 KNVVGARRSSWRVISSIEQKTEGSERKQQMAKEYRVKVE 344 KN+ S+ R +SS + K +E + M +Y K+E Sbjct: 350 KNLENDEESTLRALSSFQSKIRNAEDEDVMDSQYGSKIE 388 >SPBC839.10 |usp107|snu71|U1 snRNP-associated protein Usp107|Schizosaccharomyces pombe|chr 2|||Manual Length = 695 Score = 26.6 bits (56), Expect = 2.2 Identities = 28/110 (25%), Positives = 47/110 (42%), Gaps = 3/110 (2%) Frame = +3 Query: 87 DKEELVQRAKLAEQA-ERYDDMAAAMK--EVTETGVELSNEERNLLSVAYKNVVGARRSS 257 D ++RA A QA E+ + + +K E+ +L LL V + + R S Sbjct: 265 DVRSRIERA--ARQAREKNEKLLQNVKTSEIPINAADLEGINPELLPVIEEEIRSFRDQS 322 Query: 258 WRVISSIEQKTEGSERKQQMAKEYRVKVEKELREICYDVLGLLDKHLIPK 407 +K + + KEY K +++LR+ D+ LL KH I + Sbjct: 323 ---AMKKREKQRSKDEYASLYKEYTRKEQEKLRKQNDDLQNLLSKHRISR 369 >SPBC3E7.11c |||DNAJ protein Caj1/Djp1-type|Schizosaccharomyces pombe|chr 2|||Manual Length = 355 Score = 26.6 bits (56), Expect = 2.2 Identities = 21/69 (30%), Positives = 37/69 (53%), Gaps = 2/69 (2%) Frame = +3 Query: 279 EQKTEGSERKQQMAKEYRVKVEKELREICYDVLGLLDKHLIPKASNPESKVFYLKM-KGD 455 E E+ Q++A+ Y+V + +LRE YD LG + +P A ++ F+ + GD Sbjct: 43 ENPEAAREKFQKLAEAYQVLSDPKLRE-KYDKLGKVG--AVPDAGFEDAFEFFKNLFGGD 99 Query: 456 YYR-YLAEV 479 +R Y+ E+ Sbjct: 100 SFRDYVGEL 108 >SPAC323.04 |||mitochondrial ATPase |Schizosaccharomyces pombe|chr 1|||Manual Length = 487 Score = 25.8 bits (54), Expect = 3.9 Identities = 12/45 (26%), Positives = 22/45 (48%) Frame = +3 Query: 216 SVAYKNVVGARRSSWRVISSIEQKTEGSERKQQMAKEYRVKVEKE 350 S +Y + G S W+ I ++ K+ G +R ++ Y +KE Sbjct: 61 SFSYPFLKGKSDSPWQAIQLLDFKSSGQQRAAYYSERYHSFRDKE 105 >SPAC1006.04c |mcp3|mug7|sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 952 Score = 25.4 bits (53), Expect = 5.2 Identities = 30/111 (27%), Positives = 45/111 (40%), Gaps = 7/111 (6%) Frame = +3 Query: 90 KEELVQRAKLAEQAERYDDMAAAMKEVTETGVELSNEERNLLSVAYKNVVG-ARRSSWRV 266 KE L +L E + D + A + V NLL + YKNV A + Sbjct: 608 KEHLYSFLQLVEPSFAKSDSSNATESQISESVRKGISIFNLLFIVYKNVCSQAGINPSTK 667 Query: 267 ISSIEQKTEGSE------RKQQMAKEYRVKVEKELREICYDVLGLLDKHLI 401 + +++ T E + Q +EY+ K E ELR + LL+ LI Sbjct: 668 LEDLDEHTLSDELTYITKKFVQKDQEYQTK-EIELRNYKITLQSLLEDKLI 717 >SPAC1420.01c ||SPAC56E4.08c|DUF1752 family protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 580 Score = 25.4 bits (53), Expect = 5.2 Identities = 15/42 (35%), Positives = 24/42 (57%), Gaps = 1/42 (2%) Frame = +1 Query: 25 FSPSDK-GISELVLFHRPRCPSTRKNWCNVPNWPNKLSDMTT 147 FSP +K + +L LFH + PS+++ V N + SD +T Sbjct: 162 FSPPEKPSMKDLALFHGNKSPSSKETIPKVSN--SNSSDTST 201 >SPBC6B1.04 |mde4||monopolin-like complex subunit Mde4|Schizosaccharomyces pombe|chr 2|||Manual Length = 421 Score = 25.4 bits (53), Expect = 5.2 Identities = 16/43 (37%), Positives = 25/43 (58%), Gaps = 2/43 (4%) Frame = +3 Query: 300 ERKQQMAKEYRVKVEKELREICYDV--LGLLDKHLIPKASNPE 422 E++Q A +YR+KVE+ +I V + L+ L + SNPE Sbjct: 85 EQEQNEANDYRLKVERLEHKISDYVQEINSLNSQLQIQKSNPE 127 >SPAC3A11.05c |kms1||meiotic spindle pole body protein Kms1|Schizosaccharomyces pombe|chr 1|||Manual Length = 607 Score = 25.0 bits (52), Expect = 6.8 Identities = 25/117 (21%), Positives = 45/117 (38%), Gaps = 5/117 (4%) Frame = +3 Query: 171 TETGVELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTEGSERKQQMAKEYRVKVEKE 350 T +G+ + +E + L V Y ++ + I + S + + ++ E Sbjct: 278 TNSGLYSTKKELSALQVRYATLLRKFTDQTKKIEELSLAASRSSENENTIRRLALE-NHE 336 Query: 351 LREICYDVLGLLD-----KHLIPKASNPESKVFYLKMKGDYYRYLAEVATGETRHSV 506 L+ + +D KHLI ++NP+ F D Y EV T+ SV Sbjct: 337 LKNSNNQLNNHIDDLTREKHLIALSNNPKGDEFLSPSNLDEMVYSKEVGLSFTQPSV 393 >SPBC14F5.03c |kap123||karyopherin Kap123|Schizosaccharomyces pombe|chr 2|||Manual Length = 1067 Score = 25.0 bits (52), Expect = 6.8 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +1 Query: 40 KGISELVLFHRPRCPSTRKNWCNVPNW 120 +G+ + L RC +T CNVP W Sbjct: 694 EGVRKSALSSLWRCATTYYKVCNVPQW 720 >SPAC19B12.03 |bgs3||1,3-beta-glucan synthase subunit Bgs3|Schizosaccharomyces pombe|chr 1|||Manual Length = 1826 Score = 25.0 bits (52), Expect = 6.8 Identities = 23/79 (29%), Positives = 40/79 (50%), Gaps = 5/79 (6%) Frame = +3 Query: 9 AGSNTFFPFRQGHQ*ISSLPSSTMSVDK---EELVQRAKL--AEQAERYDDMAAAMKEVT 173 AGS+ FP+ +GH +S S M VD+ E +V+ + A++A YD + A+ T Sbjct: 96 AGSSFMFPYNRGHP-LSKRHDSIM-VDEFGHEYIVEGDSIASADEAIDYDALYASWTAET 153 Query: 174 ETGVELSNEERNLLSVAYK 230 + + + E + +A K Sbjct: 154 KAPILAIDIENIYIELAMK 172 >SPAC589.12 ||SPAC688.01|glycosylceramide biosynthesis protein |Schizosaccharomyces pombe|chr 1|||Manual Length = 971 Score = 25.0 bits (52), Expect = 6.8 Identities = 13/42 (30%), Positives = 18/42 (42%) Frame = +3 Query: 393 HLIPKASNPESKVFYLKMKGDYYRYLAEVATGETRHSVVEDS 518 H SNP S K KG++ Y A G ++ +DS Sbjct: 225 HTSKTYSNPSSFATRKKEKGEHLSYAEAAAVGTQAKNIKKDS 266 >SPAC3G6.11 |||ATP-dependent DNA helicase Chl1|Schizosaccharomyces pombe|chr 1|||Manual Length = 844 Score = 24.6 bits (51), Expect = 9.0 Identities = 16/36 (44%), Positives = 21/36 (58%), Gaps = 3/36 (8%) Frame = +3 Query: 372 VLGLLDKHLIPKASN-PESKVFYLKMKGD--YYRYL 470 VL L+ L+ A+ PE K+FY K GD Y +YL Sbjct: 509 VLMQLESFLLNIANPAPEGKLFYEKQTGDNPYLKYL 544 >SPBC11C11.07 |rpl1801|rpl18-1, rpl18|60S ribosomal protein L18|Schizosaccharomyces pombe|chr 2|||Manual Length = 187 Score = 24.6 bits (51), Expect = 9.0 Identities = 12/32 (37%), Positives = 20/32 (62%), Gaps = 2/32 (6%) Frame = +3 Query: 384 LDKHLIPKA--SNPESKVFYLKMKGDYYRYLA 473 +++H + K+ S P S+ YLK+ YR+LA Sbjct: 5 IERHHVKKSQRSKPASENVYLKLLVKLYRFLA 36 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,114,934 Number of Sequences: 5004 Number of extensions: 38572 Number of successful extensions: 150 Number of sequences better than 10.0: 19 Number of HSP's better than 10.0 without gapping: 144 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 148 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 212331630 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -