BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS312B12f (521 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAPJ691.02 |||yippee-like protein|Schizosaccharomyces pombe|chr... 77 1e-15 SPBC216.04c |||methionine sulfoxide |Schizosaccharomyces pombe|c... 27 2.2 SPAPB1E7.07 |glt1||glutamate synthase Glt1 |Schizosaccharomyces ... 26 3.0 SPAC23D3.10c |eng2||endo-1,3-beta-glucanase Eng2|Schizosaccharom... 26 3.9 >SPAPJ691.02 |||yippee-like protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 131 Score = 77.4 bits (182), Expect = 1e-15 Identities = 38/102 (37%), Positives = 58/102 (56%) Frame = +2 Query: 53 MGKIFLDHIGGTRLFSCASCDVNLTNRSELISTRFTGATGRAFLFHKVVNLIYSEVQDRV 232 MG+ + H+ +R + CA C +L + L+S + G G A LF +V N+I E + Sbjct: 1 MGRYYPVHLK-SRCYVCAKCKTHLAFKGHLLSHDYRGKNGPACLFKRVENVIEMEPKTEQ 59 Query: 233 MLTGRHMVRDVSCKNCGTKLGWVYEFATEENQRYKEGRVILE 358 M TGR +VR + C C T +GW Y + E +Q++K+G ILE Sbjct: 60 MSTGRFIVRHIHCCRCHTYIGWKYVSSYEPSQKFKDGHYILE 101 >SPBC216.04c |||methionine sulfoxide |Schizosaccharomyces pombe|chr 2|||Manual Length = 138 Score = 26.6 bits (56), Expect = 2.2 Identities = 21/72 (29%), Positives = 31/72 (43%) Frame = +2 Query: 92 LFSCASCDVNLTNRSELISTRFTGATGRAFLFHKVVNLIYSEVQDRVMLTGRHMVRDVSC 271 +F CA+C L S T+F G F + + ++D G H V V C Sbjct: 46 VFVCAACKELLYKAS----TKFESHCGWPAFFDNLPGKV-KRIEDNSY--GMHRVEAV-C 97 Query: 272 KNCGTKLGWVYE 307 NCG LG +++ Sbjct: 98 ANCGGHLGHIFK 109 >SPAPB1E7.07 |glt1||glutamate synthase Glt1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 2111 Score = 26.2 bits (55), Expect = 3.0 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = -1 Query: 269 KKHHAPCDVLLASHDPELPNRLDSQP 192 K H C V +A+ DPEL + + QP Sbjct: 1197 KCHLNTCPVGIATQDPELRKKFEGQP 1222 >SPAC23D3.10c |eng2||endo-1,3-beta-glucanase Eng2|Schizosaccharomyces pombe|chr 1|||Manual Length = 706 Score = 25.8 bits (54), Expect = 3.9 Identities = 11/32 (34%), Positives = 19/32 (59%) Frame = +3 Query: 3 FNFQINLSVLTKLNFKKWVKYFLIILEERDYF 98 FN I S +TK+NF + KY + + + + +F Sbjct: 163 FNSSILFSSITKINFSRGYKYRIQLTDGKIWF 194 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,852,159 Number of Sequences: 5004 Number of extensions: 34751 Number of successful extensions: 92 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 90 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 92 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 212331630 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -