BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS312B09f (521 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_A6YGD9 Cluster: RNA polymerase beta chain; n=1; Leptosi... 33 5.2 UniRef50_Q4T9H5 Cluster: Chromosome 12 SCAF7567, whole genome sh... 32 6.9 UniRef50_Q4FPM0 Cluster: Xaa-Pro aminopeptidase; n=5; Bacteria|R... 32 6.9 UniRef50_O16977 Cluster: Zinc metalloproteinase nas-32 precursor... 32 6.9 UniRef50_Q55CM5 Cluster: Putative uncharacterized protein; n=1; ... 32 9.2 >UniRef50_A6YGD9 Cluster: RNA polymerase beta chain; n=1; Leptosira terrestris|Rep: RNA polymerase beta chain - Leptosira terrestris (Pleurastrum terrestre) Length = 1142 Score = 32.7 bits (71), Expect = 5.2 Identities = 18/49 (36%), Positives = 29/49 (59%), Gaps = 2/49 (4%) Frame = -2 Query: 148 PLEAYLKSSSFSSAL-LPVTWGRRNMFSPS-ILLYHIPYHSPLTHIVFH 8 P EA LKS +F+SAL +PV + +N +LL H+P+ + H + + Sbjct: 66 PKEAVLKSKTFASALFIPVEYRAKNSIGLYWVLLGHLPFMTKRGHFIIN 114 >UniRef50_Q4T9H5 Cluster: Chromosome 12 SCAF7567, whole genome shotgun sequence; n=3; Chordata|Rep: Chromosome 12 SCAF7567, whole genome shotgun sequence - Tetraodon nigroviridis (Green puffer) Length = 603 Score = 32.3 bits (70), Expect = 6.9 Identities = 19/54 (35%), Positives = 28/54 (51%), Gaps = 5/54 (9%) Frame = -2 Query: 166 KKQFL--FPLEAYLKSSSFSSALLPVTWGRRNMFSPSILLY---HIPYHSPLTH 20 KK FL F L + F+S+ W R N F+PSI + H+ +H+P+ H Sbjct: 243 KKDFLGIFCLSRGVIMLLFASSAASSAWSRSNSFTPSISHHTNGHLQHHTPMPH 296 >UniRef50_Q4FPM0 Cluster: Xaa-Pro aminopeptidase; n=5; Bacteria|Rep: Xaa-Pro aminopeptidase - Pelagibacter ubique Length = 564 Score = 32.3 bits (70), Expect = 6.9 Identities = 16/38 (42%), Positives = 24/38 (63%) Frame = +2 Query: 236 GVIASKAPGKFISRTGRPVKIDTL*Y*YKTKRTFNYKN 349 G+I S PG F + ++I+ L Y KTKR+FN++N Sbjct: 477 GMILSNEPG-FYKKNHFGIRIENLIYAKKTKRSFNFEN 513 >UniRef50_O16977 Cluster: Zinc metalloproteinase nas-32 precursor; n=2; Caenorhabditis|Rep: Zinc metalloproteinase nas-32 precursor - Caenorhabditis elegans Length = 651 Score = 32.3 bits (70), Expect = 6.9 Identities = 20/60 (33%), Positives = 32/60 (53%), Gaps = 6/60 (10%) Frame = -2 Query: 394 KFYPGLKVYL-----V*TTFIFVIKGAFCFVLVL*CVDFDRASSSTNEFSRSLGCY-DTG 233 +F+PG VY + TT +++ A F+ C+ F+ S++TN +GCY DTG Sbjct: 210 QFWPGKVVYYYFDSGLTTTVQQIVRDAITFLESNTCLKFELNSTATNRIFSGVGCYSDTG 269 >UniRef50_Q55CM5 Cluster: Putative uncharacterized protein; n=1; Dictyostelium discoideum AX4|Rep: Putative uncharacterized protein - Dictyostelium discoideum AX4 Length = 1080 Score = 31.9 bits (69), Expect = 9.2 Identities = 19/55 (34%), Positives = 30/55 (54%), Gaps = 6/55 (10%) Frame = -2 Query: 157 FLFPLEAYLKSS-SFSSALLPVTWGRRNMFSPSILL-----YHIPYHSPLTHIVF 11 F+F + +L S SS LLP T+G+ S L Y +P++SP+TH+ + Sbjct: 104 FIFFVFLFLASGIMMSSKLLPFTFGKFMFISYYFLTFTEVKYRVPFYSPITHLKY 158 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 551,914,238 Number of Sequences: 1657284 Number of extensions: 10992408 Number of successful extensions: 25764 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 25075 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 25761 length of database: 575,637,011 effective HSP length: 95 effective length of database: 418,195,031 effective search space used: 32619212418 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -