BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS312B09f (521 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative different... 24 3.6 CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transpos... 23 4.7 >AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative differentiation regulator protein. Length = 1283 Score = 23.8 bits (49), Expect = 3.6 Identities = 15/37 (40%), Positives = 22/37 (59%) Frame = -2 Query: 151 FPLEAYLKSSSFSSALLPVTWGRRNMFSPSILLYHIP 41 FP++AY S+F S +P N+F+P+ L YH P Sbjct: 362 FPIDAY---SAFGS--IP-GMPPANLFNPAALAYHDP 392 >CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transposon polyprotein protein. Length = 1726 Score = 23.4 bits (48), Expect = 4.7 Identities = 12/35 (34%), Positives = 16/35 (45%) Frame = -3 Query: 222 QRGHMQNLH*KLNRNIETAKNSFCFLWKLTLNHHH 118 +RGH+ LH N A N L+KL + H Sbjct: 1483 RRGHVTELHSDNGTNFRGANNKLRELYKLLNSDTH 1517 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 589,765 Number of Sequences: 2352 Number of extensions: 11053 Number of successful extensions: 14 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 47783067 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -