BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS312B07f (521 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY146745-1|AAO12105.1| 153|Anopheles gambiae odorant-binding pr... 24 3.6 AJ697725-1|CAG26918.1| 153|Anopheles gambiae putative odorant-b... 24 3.6 AF437886-1|AAL84181.1| 153|Anopheles gambiae odorant binding pr... 24 3.6 AF283275-1|AAG15376.1| 133|Anopheles gambiae small heat shock p... 23 6.2 DQ974170-1|ABJ52810.1| 511|Anopheles gambiae serpin 12 protein. 23 8.2 >AY146745-1|AAO12105.1| 153|Anopheles gambiae odorant-binding protein AgamOBP3 protein. Length = 153 Score = 23.8 bits (49), Expect = 3.6 Identities = 10/33 (30%), Positives = 19/33 (57%) Frame = -3 Query: 486 ALLHVISDSISKEKRHPPIQLLQFLLGLEVCCI 388 A+L V SD ++ +PP +LL+ + + C+ Sbjct: 23 AILMVRSDEPRRDANYPPPELLEKMKPMHDACV 55 >AJ697725-1|CAG26918.1| 153|Anopheles gambiae putative odorant-binding protein OBPjj15 protein. Length = 153 Score = 23.8 bits (49), Expect = 3.6 Identities = 10/33 (30%), Positives = 19/33 (57%) Frame = -3 Query: 486 ALLHVISDSISKEKRHPPIQLLQFLLGLEVCCI 388 A+L V SD ++ +PP +LL+ + + C+ Sbjct: 23 AILMVRSDEPRRDANYPPPELLEKMKPMHDACV 55 >AF437886-1|AAL84181.1| 153|Anopheles gambiae odorant binding protein protein. Length = 153 Score = 23.8 bits (49), Expect = 3.6 Identities = 10/33 (30%), Positives = 19/33 (57%) Frame = -3 Query: 486 ALLHVISDSISKEKRHPPIQLLQFLLGLEVCCI 388 A+L V SD ++ +PP +LL+ + + C+ Sbjct: 23 AILMVRSDEPRRDANYPPPELLEKMKPMHDACV 55 >AF283275-1|AAG15376.1| 133|Anopheles gambiae small heat shock protein protein. Length = 133 Score = 23.0 bits (47), Expect = 6.2 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -2 Query: 520 DGKTVEAEAAHGTVTRHF 467 +GK E + HG V+RHF Sbjct: 41 EGKHEEKQDDHGYVSRHF 58 >DQ974170-1|ABJ52810.1| 511|Anopheles gambiae serpin 12 protein. Length = 511 Score = 22.6 bits (46), Expect = 8.2 Identities = 8/34 (23%), Positives = 16/34 (47%) Frame = -2 Query: 376 DNNDALKNFAETLEKVCIETIESGIMTKDLAICI 275 +N D LK + + T++ ++ + ICI Sbjct: 367 NNKDGLKELIKNFNPDTLSTVQKSLVQMPVQICI 400 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 477,634 Number of Sequences: 2352 Number of extensions: 8017 Number of successful extensions: 23 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 23 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 23 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 47783067 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -