BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS312B05f (521 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase rever... 23 2.2 AM292374-1|CAL23186.2| 659|Tribolium castaneum gustatory recept... 22 2.9 AM292373-1|CAL23185.2| 360|Tribolium castaneum gustatory recept... 22 2.9 AM292353-1|CAL23165.2| 651|Tribolium castaneum gustatory recept... 22 2.9 >DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase reverse transcriptase protein. Length = 596 Score = 22.6 bits (46), Expect = 2.2 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = -2 Query: 73 YYREIKRFHGVRTKYLRK 20 YY+ IK +G K++RK Sbjct: 134 YYKPIKTLNGHEIKFIRK 151 >AM292374-1|CAL23186.2| 659|Tribolium castaneum gustatory receptor candidate 53 protein. Length = 659 Score = 22.2 bits (45), Expect = 2.9 Identities = 7/24 (29%), Positives = 14/24 (58%) Frame = +1 Query: 103 ILPVWGAFTD*NI*FLVNSCFKSL 174 +L W AF N+ ++ N C+ ++ Sbjct: 271 LLTFWSAFFIVNVLYICNQCYNTV 294 >AM292373-1|CAL23185.2| 360|Tribolium castaneum gustatory receptor candidate 52 protein. Length = 360 Score = 22.2 bits (45), Expect = 2.9 Identities = 13/39 (33%), Positives = 19/39 (48%) Frame = -3 Query: 294 FFKPNVLSSITFSFFFCSVFLLAPLGFLGGMVRFRLVTF 178 +F+ VL + F+FF LL L +RF+L F Sbjct: 152 YFQMYVLFFVNFAFFVVVKMLLVRYRNLTKQLRFKLRFF 190 >AM292353-1|CAL23165.2| 651|Tribolium castaneum gustatory receptor candidate 32 protein. Length = 651 Score = 22.2 bits (45), Expect = 2.9 Identities = 13/39 (33%), Positives = 19/39 (48%) Frame = -3 Query: 294 FFKPNVLSSITFSFFFCSVFLLAPLGFLGGMVRFRLVTF 178 +F+ VL + F+FF LL L +RF+L F Sbjct: 152 YFQMYVLFFVNFAFFVVVKMLLVRYRNLTKQLRFKLRFF 190 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 103,498 Number of Sequences: 336 Number of extensions: 1884 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12573240 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -